PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC7AG007210.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family BBR-BPC
Protein Properties Length: 341aa    MW: 37542.7 Da    PI: 8.8969
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC7AG007210.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind378.31.3e-1153534114301
         GAGA_bind  14 yepaaslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalllvensla...salpvgvqvls 103
                         p++++k++ +++l+++++erd++i er++al+ekkaa+aerdmaf+qrd+a+aern+a+verdn+l+al+l++++     s ++++ ++l+
  TRIDC7AG007210.1  35 MMPQRQMKDHHSMNLLALMSERDTAIMERDHALAEKKAAMAERDMAFAQRDSAMAERNAAIVERDNALAALELARTNGFnmnSGNGFNPGSLN 127
                       34779******************************************************************9998875545588889999*** PP

         GAGA_bind 104 gtksidslqqlse.....pqledsave.lreeeklealpieeaaee.akekkkkkkrqrakkpkekkak..kkkkksekskkkvkkesader. 186
                       g+k+ ++++q+ +      ql+ds+++ +re+++++a+pi++a+ + a ++kk+kk++++++p+++ +   +k+kk   ++++  ++++ e+ 
  TRIDC7AG007210.1 128 GAKNFHHHDQQPHaqsspLQLADSPYDhAREMHISDAYPISTAPVTaAGKAKKPKKNSSQASPLKRPSGvlRKTKKAGGDWRDAGMSGVGEDp 220
                       ********99877789999********9*************9976516789999***********9999887777788899999998877556 PP

         GAGA_bind 187 ......skaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLa 273
                             +k+e+k++dl+ln+vs+Des++P+P+CsCtG+lrqCYkWGnGGWqS+CCt+++S+yPLPv++++r+aR++grKmS++af+klL++La
  TRIDC7AG007210.1 221 araaseMKNERKDQDLGLNQVSFDESSMPAPACSCTGVLRQCYKWGNGGWQSSCCTMSMSMYPLPVMPNKRHARMGGRKMSGSAFTKLLSRLA 313
                       788888*************************************************************************************** PP

         GAGA_bind 274 aeGydlsnpvDLkdhWAkHGtnkfvtir 301
                       aeG+dls  vDLkdhWAkHGtn+++tir
  TRIDC7AG007210.1 314 AEGHDLSASVDLKDHWAKHGTNRYITIR 341
                       ***************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    
TNIMLYIFFL IIIVGMICSL EECGSYDSCS VFQWMMPQRQ MKDHHSMNLL ALMSERDTAI  60
MERDHALAEK KAAMAERDMA FAQRDSAMAE RNAAIVERDN ALAALELART NGFNMNSGNG  120
FNPGSLNGAK NFHHHDQQPH AQSSPLQLAD SPYDHAREMH ISDAYPISTA PVTAAGKAKK  180
PKKNSSQASP LKRPSGVLRK TKKAGGDWRD AGMSGVGEDP ARAASEMKNE RKDQDLGLNQ  240
VSFDESSMPA PACSCTGVLR QCYKWGNGGW QSSCCTMSMS MYPLPVMPNK RHARMGGRKM  300
SGSAFTKLLS RLAAEGHDLS ASVDLKDHWA KHGTNRYITI R
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42520.13e-91BBR-BPC family protein