PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC6BG056910.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 685aa    MW: 75116.4 Da    PI: 6.7846
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC6BG056910.3genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.81.2e-201772156
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                      +++ +++t+ q+++Le++F+++++p++++r +L+++lgL+ rq+k+WFqNrR+++k
  TRIDC6BG056910.3 17 KKRYHRHTPRQIQQLEAMFKECPHPDENQRMHLSRELGLEPRQIKFWFQNRRTQMK 72
                      678899***********************************************998 PP

2START163.91.2e-512104342206
                       HHHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEE CS
             START   2 laeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv.......dsgealrasgvvdmvlallveellddkeqWdetla....kae 80 
                       +a +a++e++++a+a+e +Wvk +   e +n d++ ++f++ ++        ++e +r+s +v   +  lv +++d++ +W+e ++    +a 
  TRIDC6BG056910.3 210 MATRAMDEFIRLAQAGEHLWVKAAggrEVLNVDTYDSIFAKPGSssfrgpdVHVEGSRDSCLVLTSAIALVDTFMDSS-KWTEFFPtivtRAR 301
                       5789***********************99999999999987766899*******************************.************** PP

                       EEEEECTT.....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEE CS
             START  81 tlevissg.....galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwv 167
                       t++v+ +g     + l+lm+ el ++sp+vp R+f f+Ry+rq ++g w+i+dvSvd +++    ++ +R+++lpSg+li ++sng+skvtwv
  TRIDC6BG056910.3 302 TIDVLVNGmagrsESLVLMYEELHVMSPVVPtREFCFLRYCRQIEQGLWAIADVSVDLQRDARYGAPPARSRRLPSGCLIADMSNGYSKVTWV 394
                       *************************************************************988***************************** PP

                       E-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 168 ehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                       eh++ ++++p  +l+r lv sg+a+ga +w+a+lqr ce+
  TRIDC6BG056910.3 395 EHMETEDKTPiNQLYRDLVLSGAAFGAHRWLAALQRACER 434
                       **************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 685 aa     Download sequence    
MDFGDDLVPG SDAHRRKKRY HRHTPRQIQQ LEAMFKECPH PDENQRMHLS RELGLEPRQI  60
KFWFQNRRTQ MKAQHERADN CFLRAENDKI RCENIAMREA LKNVICPTCG GPHSGADDYF  120
DEHKLRMENA HLKEELDRVS SLTSKYLGRP ITQLPSMQPL SMSSLELSVG GLGSPLALGP  180
ALDLDPLGGS SPFQLPAPVS EMERPMMAEM ATRAMDEFIR LAQAGEHLWV KAAGGREVLN  240
VDTYDSIFAK PGSSSFRGPD VHVEGSRDSC LVLTSAIALV DTFMDSSKWT EFFPTIVTRA  300
RTIDVLVNGM AGRSESLVLM YEELHVMSPV VPTREFCFLR YCRQIEQGLW AIADVSVDLQ  360
RDARYGAPPA RSRRLPSGCL IADMSNGYSK VTWVEHMETE DKTPINQLYR DLVLSGAAFG  420
AHRWLAALQR ACERHACLVT PPHRDIAGVT LEGKRSMMRL SQRMVGSFCA SLSASQQHRW  480
TTLSGPGAGV DDAAGVRVMV HRSTDPGQPS GVVLTAATSI WLPVSCDRVF AFVRDENTRS  540
QWDVLSHGNP VQEVSRISNG SHPGNSISLL RGLNASQNSM LILQESCADA SGSLVVYAPI  600
DLPAANVVMS GEDPSSIPLL PSGFTILPDG RASSSTGSVV TVAFQILVSS LPSSRLNAES  660
VATVNSLIGT TVEQIKAALN CGSSH
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17920.10.0HD-ZIP family protein