PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC6BG052030.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 343aa    MW: 37427 Da    PI: 4.3054
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC6BG052030.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.41.6e-2076129356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k++++t+eq++ Le+ Fe+++++  e+++eLA+klgL+ rqV vWFqNrRa++k
  TRIDC6BG052030.2  76 KKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWK 129
                       5678*************************************************9 PP

2HD-ZIP_I/II129.21.7e-4175166192
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                       ekkrrl+ eqv+lLE+sFeee+kLeperK+elar+LglqprqvavWFqnrRAR+ktk lE+d+++Lk+++dal++++++L +++++L +++ 
  TRIDC6BG052030.2  75 EKKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWKTKTLERDFDRLKASFDALRADHDALLQDNHRLLSQVV 166
                       69*************************************************************************************99986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    
MEPGRLIFNT SGSGNGQMLF MDCGAGGIAG AAGVFHRGVR PVLGGMEEGR GVKRPFFTSP  60
DDMLEEEYYD EQLPEKKRRL TPEQVHLLER SFEEENKLEP ERKTELARKL GLQPRQVAVW  120
FQNRRARWKT KTLERDFDRL KASFDALRAD HDALLQDNHR LLSQVVTLTE KMQDKEAPEG  180
SFGAAVDASE PEQAAAEAEA KTSLADAEEQ AAAAEAFEVV QQQQQLHVKD EERLSPGSGG  240
SAVLDARDAL LGSGCGLAGV VDSSVDSYCF PGGAGGDEYH ECVMGPVAGG IQSEEDDGAG  300
SDEGCSYYPD DAAVFFAAAQ GHSHHHTDDD DQDDGQISYW MWN
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.11e-56HD-ZIP family protein