PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC6BG046200.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 807aa    MW: 87612.1 Da    PI: 7.4725
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC6BG046200.5genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.31.9e-21103158156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++eLe+lF+++++p++++r+eL+k+l+L+ rqVk+WFqNrR+++k
  TRIDC6BG046200.5 103 KKRYHRHTPQQIQELEALFKECPHPDEKQRAELSKRLSLDARQVKFWFQNRRTQMK 158
                       678899***********************************************999 PP

2START180.78e-573175491206
                       HHHHHHHHHHHHHHHHC-TT-EEEE......EXCCTTEEEEEEESSS......SCEEEEEEEECCSCH.HHHHHHHHCCCGGCT-TT-S.... CS
             START   1 elaeeaaqelvkkalaeepgWvkss......esengdevlqkfeeskv.....dsgealrasgvvdmv.lallveellddkeqWdetla.... 77 
                       ela +a++elvk+a+ ++p+Wv+        es+n +e+l + +   +     + +ea+r+sg+v+ + ++ lve+l+d + +W+ ++     
  TRIDC6BG046200.5 317 ELAISAMDELVKMAQTDDPLWVTGLpgfpdkESLNFEEYLHSSQHCIGmkpagFVSEASRESGLVIIDnSVALVETLIDER-RWSDMFScmia 408
                       57889******************9999999999999999999966655999999*********998651669*********.**********9 PP

                       EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--......-TTSEE-EESSEEEEEEEEC CS
             START  78 kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.....sssvvRaellpSgiliepks 158
                       ka++le +s+g      gal lm+aelq+lsplvp R++ f+R+++ql +g w++vdvS+d   ++++          ++++lpSg+++++++
  TRIDC6BG046200.5 409 KATILEEVSNGiggsrnGALLLMKAELQVLSPLVPiREVIFLRFCKQLAEGAWAVVDVSIDGLLSNQNsattsAGANLKCRRLPSGCVMQDTP 501
                       *************************************************************88777776654222358*************** PP

                       TCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 159 nghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                       ng++kvtwveh++++++++h+ +r+l++sgla+ga++w+atlqrqce+
  TRIDC6BG046200.5 502 NGYCKVTWVEHTEYDEASVHQFYRPLLRSGLAFGASRWLATLQRQCEC 549
                       **********************************************96 PP

Sequence ? help Back to Top
Protein Sequence    Length: 807 aa     Download sequence    
ELRGPLRRRR RRRRHAVPLR RRLLVLARAL PRAGTRSALD NAGGRDGGIG GRMFADGAGG  60
AMARDAEAQN DSRSGSDHLD AISGVGDDDD DAEPSGSNPR KRKKRYHRHT PQQIQELEAL  120
FKECPHPDEK QRAELSKRLS LDARQVKFWF QNRRTQMKTQ LERHENALLK QENEKLRTEN  180
LTIREAMRTP MCGGCGSPAM LGEVSLEEQH LRIENARLKD ELNRVCTLAT KFLGKPVSLL  240
SPLQLQPHLS MPLPNSSLEL AVGGIGGIGS MQPSMHGMMS EYAGGASSSM GTVITPARAT  300
GSALASMVDI DRSVFLELAI SAMDELVKMA QTDDPLWVTG LPGFPDKESL NFEEYLHSSQ  360
HCIGMKPAGF VSEASRESGL VIIDNSVALV ETLIDERRWS DMFSCMIAKA TILEEVSNGI  420
GGSRNGALLL MKAELQVLSP LVPIREVIFL RFCKQLAEGA WAVVDVSIDG LLSNQNSATT  480
SAGANLKCRR LPSGCVMQDT PNGYCKVTWV EHTEYDEASV HQFYRPLLRS GLAFGASRWL  540
ATLQRQCECL AILMSSATVS PNEPTAISQE GKRSMLKLAR RMTENFCAGV SASSAREWSK  600
LDGATGSIGE DVRVMARKSV SEPGEPPGVV LSAATSVWVP IAPEKLFDFL RDEQLRAEWD  660
ILSNGGPMQE MARIAKGHQN GNSVSLLRAS AMSANQSSML ILQETCTDAS GSIVVYAPVD  720
IPAMQLVMNG GDSTYVALLP SGFAILPDGP SIGSEHKTGG SLLTVAFQIL VNSQPTAKLT  780
VESVETVNNL ISCTIKKIKT ALQCATP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1312RGPLRRRRRR
2712RRRRRR
3713RRRRRRR
4714RRRRRRRR
5722RRRRRRRRHAVPLRRR
6813RRRRRR
7814RRRRRRR
8815RRRRRRRR
9823RRRRRRRRHAVPLRRR
10914RRRRRR
1199105PRKRKKR
12100104RKRKK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein