PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC6BG046200.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 417aa    MW: 45367.3 Da    PI: 6.2988
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC6BG046200.4genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox68.68e-2287142156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++eLe+lF+++++p++++r+eL+k+l+L+ rqVk+WFqNrR+++k
  TRIDC6BG046200.4  87 KKRYHRHTPQQIQELEALFKECPHPDEKQRAELSKRLSLDARQVKFWFQNRRTQMK 142
                       678899***********************************************999 PP

2START353.4e-12301413192
                       HHHHHHHHHHHHHHHHC-TT-EEEE......EXCCTTEEEEEEESSS......SCEEEEEEEECCSCH.HHHHHHHHCCCGGCT-TT-S.... CS
             START   1 elaeeaaqelvkkalaeepgWvkss......esengdevlqkfeeskv.....dsgealrasgvvdmv.lallveellddkeqWdetla.... 77 
                       ela +a++elvk+a+ ++p+Wv+        es+n +e+l + +   +     + +ea+r+sg+v+ + ++ lve+l+d + +W+ ++     
  TRIDC6BG046200.4 301 ELAISAMDELVKMAQTDDPLWVTGLpgfpdkESLNFEEYLHSSQHCIGmkpagFVSEASRESGLVIIDnSVALVETLIDER-RWSDMFScmia 392
                       57889******************9999999999999999999966655999999*********998651669*********.*******9999 PP

                       EEEEEEEECTT......EEEE CS
             START  78 kaetlevissg......galq 92 
                       ka++le +s+g      gal 
  TRIDC6BG046200.4 393 KATILEEVSNGiggsrnGALL 413
                       **********98777766665 PP

Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    
APSRPRPRSP SGWYAFGARH GRNDNAGGRD GGIGGRMFAD GAGGAMARDA EAQNDSRSGS  60
DHLDAISGVG DDDDDAEPSG SNPRKRKKRY HRHTPQQIQE LEALFKECPH PDEKQRAELS  120
KRLSLDARQV KFWFQNRRTQ MKTQLERHEN ALLKQENEKL RTENLTIREA MRTPMCGGCG  180
SPAMLGEVSL EEQHLRIENA RLKDELNRVC TLATKFLGKP VSLLSPLQLQ PHLSMPLPNS  240
SLELAVGGIG GIGSMQPSMH GMMSEYAGGA SSSMGTVITP ARATGSALAS MVDIDRSVFL  300
ELAISAMDEL VKMAQTDDPL WVTGLPGFPD KESLNFEEYL HSSQHCIGMK PAGFVSEASR  360
ESGLVIIDNS VALVETLIDE RRWSDMFSCM IAKATILEEV SNGIGGSRNG ALLLVSA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18389PRKRKKR
28488RKRKK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.21e-124HD-ZIP family protein