PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC6AG044320.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 342aa    MW: 37802.4 Da    PI: 4.8491
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC6AG044320.3genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.41.6e-2078131356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k++++t+eq++ Le+ Fe+++++  e+++eLA+klgL+ rqV vWFqNrRa++k
  TRIDC6AG044320.3  78 KKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWK 131
                       5678*************************************************9 PP

2HD-ZIP_I/II130.66.2e-4277168192
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                       ekkrrl+ eqv+lLE+sFeee+kLeperK+elar+LglqprqvavWFqnrRAR+ktk lE+d+++Lk+++dal++++++L +++++Lr+++ 
  TRIDC6AG044320.3  77 EKKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWKTKTLERDFDRLKASFDALRADHDALLQDNHRLRSQVV 168
                       69**************************************************************************************9986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    
GARPAHLQHV GLRQRTDALH GLRRGRHRRR GRHVPSSDEG VRPVLGGMEE GRGVKRPFFT  60
SPDDMLEEEY YDEQLPEKKR RLTPEQVHLL ERSFEEENKL EPERKTELAR KLGLQPRQVA  120
VWFQNRRARW KTKTLERDFD RLKASFDALR ADHDALLQDN HRLRSQVVTL TEKMQDKEAP  180
EGSFGAAADA SEPEQAAAEA KASLADAEEQ AAAAEAFEVV QQQLHVKDEE RLSPGSGGSA  240
VLDARDALLG SGCGLAGVVD SSVDSYCFPG GAGGDEYHEC VVGPVAGGIH SEEDDGAGSD  300
EGCSYYPDDA AVFFAAAQGH GHHHTDDDDQ QDDGQISYWM WN
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.11e-56HD-ZIP family protein