PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC6AG041950.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family ZF-HD
Protein Properties Length: 277aa    MW: 29234.4 Da    PI: 10.5307
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC6AG041950.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer99.13.2e-313385458
       ZF-HD_dimer  4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                      +rY+eCl+NhAa++G+h++DGCgEfmps+g+   +aal CaACgCHR+FHRre++
  TRIDC6AG041950.1 33 WRYRECLRNHAARMGAHVLDGCGEFMPSPGDG--PAALACAACGCHRSFHRREPV 85
                      69**************************8887..******************975 PP

2Homeobox14.85e-05180236153
                       TT--SS--HHHHHHHHHHHH....HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFe....knrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                       +r Rt+ft+eq e++ e+ +    + ++p+        +++g++ r+ kvW +N + 
  TRIDC6AG041950.1 180 KRFRTKFTPEQKERMLEFAHrvgwRVQKPDGGVVDAFCAQVGVPRRVLKVWMHNNKH 236
                       789*********98765444688789****************************986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    
MPPPPPTLAI VTGGATRAPG EHGGASGPEP LPWRYRECLR NHAARMGAHV LDGCGEFMPS  60
PGDGPAALAC AACGCHRSFH RREPVVLVPS PSPSPASAVV SPSATPAGAN SRLMPLLLAP  120
PHMQQKRPHV PASPMSAPAA LAESSSEELR APPPPPPPPQ AQAQAAAGGS ASAPPAPSKK  180
RFRTKFTPEQ KERMLEFAHR VGWRVQKPDG GVVDAFCAQV GVPRRVLKVW MHNNKHLAKT  240
SATSPPPLPP LHHDPSPPAP HQHQHHPAPP PHHQQQQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.14e-24ZF-HD family protein