PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC6AG039350.7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 809aa    MW: 87053.1 Da    PI: 6.0351
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC6AG039350.7genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.31.9e-21105160156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++eLe+lF+++++p++++r+eL+k+l+L+ rqVk+WFqNrR+++k
  TRIDC6AG039350.7 105 KKRYHRHTPQQIQELEALFKECPHPDEKQRAELSKRLSLDARQVKFWFQNRRTQMK 160
                       678899***********************************************999 PP

2START183.21.5e-573195511206
                       HHHHHHHHHHHHHHHHC-TT-EEEE......EXCCTTEEEEEEESSS......SCEEEEEEEECCSCH.HHHHHHHHCCCGGCT-TT-S.... CS
             START   1 elaeeaaqelvkkalaeepgWvkss......esengdevlqkfeeskv.....dsgealrasgvvdmv.lallveellddkeqWdetla.... 77 
                       ela +a++elvk+a+ ++p+Wv+        es+n +e+l + +   +     + +ea+r+sg+v+ + ++ lve+l+d + +W+ ++     
  TRIDC6AG039350.7 319 ELAISAMDELVKMAQTDDPLWVTGLpgfpdkESLNFEEYLHSSQHCIGmkpvgFVSEASRESGLVIIDnSVALVETLMDER-RWSDMFScmia 410
                       57889******************9999999999999***9999666659999***********998651669*********.*********** PP

                       EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--......-TTSEE-EESSEEEEEEEEC CS
             START  78 kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.....sssvvRaellpSgiliepks 158
                       ka++le +s+g      gal lm+aelq+lsplvp R++ f+R+++ql +g w++vdvS+d   ++++          ++++lpSg+++++++
  TRIDC6AG039350.7 411 KATILEEVSNGiggsrnGALLLMKAELQVLSPLVPiREVIFLRFCKQLAEGAWAVVDVSIDGLLSNQNsattsAGANLKCRRLPSGCVMQDTP 503
                       *************************************************************88777776654222358*************** PP

                       TCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 159 nghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                       ng++kvtwveh++++++++h+ +r+l++sgla+ga++w+atlqrqce+
  TRIDC6AG039350.7 504 NGYCKVTWVEHTEYDEASVHQFYRPLLRSGLAFGASRWLATLQRQCEC 551
                       **********************************************96 PP

Sequence ? help Back to Top
Protein Sequence    Length: 809 aa     Download sequence    
MSFGGLFDGG GGGGGMQFPY AGAFSSSPAL SLGLVRRHGR NDNAGGRDGG IGGRMFADGA  60
GGAMARDAEA QNDSRSGSDH LDAISGVGDD DDDAEPSGSN PRKRKKRYHR HTPQQIQELE  120
ALFKECPHPD EKQRAELSKR LSLDARQVKF WFQNRRTQMK TQLERHENAL LKQENEKLRT  180
ENLTIREAMR TPMCGGCGSP AMLGEVSLEE QHLRIENARL KDELNRVCTL ATKFLGKPVS  240
LLSPLQLQPH LSMPLPNSSL ELAVGGIGGI GSMQPSMHGM MSEYAGGASS SMGTVITPAR  300
ATGSALASMV DIDRSVFLEL AISAMDELVK MAQTDDPLWV TGLPGFPDKE SLNFEEYLHS  360
SQHCIGMKPV GFVSEASRES GLVIIDNSVA LVETLMDERR WSDMFSCMIA KATILEEVSN  420
GIGGSRNGAL LLMKAELQVL SPLVPIREVI FLRFCKQLAE GAWAVVDVSI DGLLSNQNSA  480
TTSAGANLKC RRLPSGCVMQ DTPNGYCKVT WVEHTEYDEA SVHQFYRPLL RSGLAFGASR  540
WLATLQRQCE CLAILMSSAT VSPNEPTAIS QEGKRSMLKL ARRMTENFCA GVSASSAREW  600
SKLDGATGSI GEDVRVMARK SVSEPGEPPG VVLSAATSVW VPIAPEKLFD FLRDEQLRAE  660
WDILSNGGPM QEMARIAKGH QNGNSVSLLR ASAMSANQSS MLILQETCTD ASGSIVVYAP  720
VDIPAMQLVM NGGDSTYVAL LPSGFAILPD GPSIGSEHKT GGSLLTVAFQ ILVNSQPTAK  780
LTVESVETVN NLISCTIKKI KTALQCATP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1101107PRKRKKR
2102106RKRKK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein