PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC6AG039350.6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 415aa    MW: 44985.9 Da    PI: 5.9855
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC6AG039350.6genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox68.67.9e-2285140156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++eLe+lF+++++p++++r+eL+k+l+L+ rqVk+WFqNrR+++k
  TRIDC6AG039350.6  85 KKRYHRHTPQQIQELEALFKECPHPDEKQRAELSKRLSLDARQVKFWFQNRRTQMK 140
                       678899***********************************************999 PP

2START37.46.1e-13299411192
                       HHHHHHHHHHHHHHHHC-TT-EEEE......EXCCTTEEEEEEESSS......SCEEEEEEEECCSCH.HHHHHHHHCCCGGCT-TT-S.... CS
             START   1 elaeeaaqelvkkalaeepgWvkss......esengdevlqkfeeskv.....dsgealrasgvvdmv.lallveellddkeqWdetla.... 77 
                       ela +a++elvk+a+ ++p+Wv+        es+n +e+l + +   +     + +ea+r+sg+v+ + ++ lve+l+d + +W+ ++     
  TRIDC6AG039350.6 299 ELAISAMDELVKMAQTDDPLWVTGLpgfpdkESLNFEEYLHSSQHCIGmkpvgFVSEASRESGLVIIDnSVALVETLMDER-RWSDMFScmia 390
                       57889******************9999999999999***9999666659999***********998651669*********.*******9999 PP

                       EEEEEEEECTT......EEEE CS
             START  78 kaetlevissg......galq 92 
                       ka++le +s+g      gal 
  TRIDC6AG039350.6 391 KATILEEVSNGiggsrnGALL 411
                       **********98777766665 PP

Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    
AGAFSSSPAL SLGLVRRHGR NDNAGGRDGG IGGRMFADGA GGAMARDAEA QNDSRSGSDH  60
LDAISGVGDD DDDAEPSGSN PRKRKKRYHR HTPQQIQELE ALFKECPHPD EKQRAELSKR  120
LSLDARQVKF WFQNRRTQMK TQLERHENAL LKQENEKLRT ENLTIREAMR TPMCGGCGSP  180
AMLGEVSLEE QHLRIENARL KDELNRVCTL ATKFLGKPVS LLSPLQLQPH LSMPLPNSSL  240
ELAVGGIGGI GSMQPSMHGM MSEYAGGASS SMGTVITPAR ATGSALASMV DIDRSVFLEL  300
AISAMDELVK MAQTDDPLWV TGLPGFPDKE SLNFEEYLHS SQHCIGMKPV GFVSEASRES  360
GLVIIDNSVA LVETLMDERR WSDMFSCMIA KATILEEVSN GIGGSRNGAL LLVSA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18187PRKRKKR
28286RKRKK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.21e-126HD-ZIP family protein