PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC6AG039350.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 758aa    MW: 82363.1 Da    PI: 6.1804
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC6AG039350.5genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox68.77.4e-2245100156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++eLe+lF+++++p++++r+eL+k+l+L+ rqVk+WFqNrR+++k
  TRIDC6AG039350.5  45 KKRYHRHTPQQIQELEALFKECPHPDEKQRAELSKRLSLDARQVKFWFQNRRTQMK 100
                       678899***********************************************998 PP

2START183.41.3e-572685001206
                       HHHHHHHHHHHHHHHHC-TT-EEEE......EXCCTTEEEEEEESSS......SCEEEEEEEECCSCH.HHHHHHHHCCCGGCT-TT-S.... CS
             START   1 elaeeaaqelvkkalaeepgWvkss......esengdevlqkfeeskv.....dsgealrasgvvdmv.lallveellddkeqWdetla.... 77 
                       ela +a++elvk+a+ ++p+Wv+        es+n +e+l + +   +     + +ea+r+sg+v+ + ++ lve+l+d + +W+ ++     
  TRIDC6AG039350.5 268 ELAISAMDELVKMAQTDDPLWVTGLpgfpdkESLNFEEYLHSSQHCIGmkpvgFVSEASRESGLVIIDnSVALVETLMDER-RWSDMFScmia 359
                       57889******************9999999999999***9999666659999***********998651669*********.*********** PP

                       EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--......-TTSEE-EESSEEEEEEEEC CS
             START  78 kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.....sssvvRaellpSgiliepks 158
                       ka++le +s+g      gal lm+aelq+lsplvp R++ f+R+++ql +g w++vdvS+d   ++++          ++++lpSg+++++++
  TRIDC6AG039350.5 360 KATILEEVSNGiggsrnGALLLMKAELQVLSPLVPiREVIFLRFCKQLAEGAWAVVDVSIDGLLSNQNsattsAGANLKCRRLPSGCVMQDTP 452
                       *************************************************************88777776654222358*************** PP

                       TCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 159 nghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                       ng++kvtwveh++++++++h+ +r+l++sgla+ga++w+atlqrqce+
  TRIDC6AG039350.5 453 NGYCKVTWVEHTEYDEASVHQFYRPLLRSGLAFGASRWLATLQRQCEC 500
                       **********************************************96 PP

Sequence ? help Back to Top
Protein Sequence    Length: 758 aa     Download sequence    
GGAMARDAEA QNDSRSGSDH LDAISGVGDD DDDAEPSGSN PRKRKKRYHR HTPQQIQELE  60
ALFKECPHPD EKQRAELSKR LSLDARQVKF WFQNRRTQMK ILTRRFRAQT QLERHENALL  120
KQENEKLRTE NLTIREAMRT PMCGGCGSPA MLGEVSLEEQ HLRIENARLK DELNRVCTLA  180
TKFLGKPVSL LSPLQLQPHL SMPLPNSSLE LAVGGIGGIG SMQPSMHGMM SEYAGGASSS  240
MGTVITPARA TGSALASMVD IDRSVFLELA ISAMDELVKM AQTDDPLWVT GLPGFPDKES  300
LNFEEYLHSS QHCIGMKPVG FVSEASRESG LVIIDNSVAL VETLMDERRW SDMFSCMIAK  360
ATILEEVSNG IGGSRNGALL LMKAELQVLS PLVPIREVIF LRFCKQLAEG AWAVVDVSID  420
GLLSNQNSAT TSAGANLKCR RLPSGCVMQD TPNGYCKVTW VEHTEYDEAS VHQFYRPLLR  480
SGLAFGASRW LATLQRQCEC LAILMSSATV SPNEPTAISQ EGKRSMLKLA RRMTENFCAG  540
VSASSAREWS KLDGATGSIG EDVRVMARKS VSEPGEPPGV VLSAATSVWV PIAPEKLFDF  600
LRDEQLRAEW DILSNGGPMQ EMARIAKGHQ NGNSVSLLRA SAMSANQSSM LILQETCTDA  660
SGSIVVYAPV DIPAMQLVMN GGDSTYVALL PSGFAILPDG PSIGSEHKTG GSLLTVAFQI  720
LVNSQPTAKL TVESVETVNN LISCTIKKIK TALQCATP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14147PRKRKKR
24246RKRKK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein