PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC6AG039350.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 804aa    MW: 86409.4 Da    PI: 5.4706
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC6AG039350.4genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.31.9e-2198153156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++eLe+lF+++++p++++r+eL+k+l+L+ rqVk+WFqNrR+++k
  TRIDC6AG039350.4  98 KKRYHRHTPQQIQELEALFKECPHPDEKQRAELSKRLSLDARQVKFWFQNRRTQMK 153
                       678899***********************************************999 PP

2START183.21.4e-573125441206
                       HHHHHHHHHHHHHHHHC-TT-EEEE......EXCCTTEEEEEEESSS......SCEEEEEEEECCSCH.HHHHHHHHCCCGGCT-TT-S.... CS
             START   1 elaeeaaqelvkkalaeepgWvkss......esengdevlqkfeeskv.....dsgealrasgvvdmv.lallveellddkeqWdetla.... 77 
                       ela +a++elvk+a+ ++p+Wv+        es+n +e+l + +   +     + +ea+r+sg+v+ + ++ lve+l+d + +W+ ++     
  TRIDC6AG039350.4 312 ELAISAMDELVKMAQTDDPLWVTGLpgfpdkESLNFEEYLHSSQHCIGmkpvgFVSEASRESGLVIIDnSVALVETLMDER-RWSDMFScmia 403
                       57889******************9999999999999***9999666659999***********998651669*********.*********** PP

                       EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--......-TTSEE-EESSEEEEEEEEC CS
             START  78 kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.....sssvvRaellpSgiliepks 158
                       ka++le +s+g      gal lm+aelq+lsplvp R++ f+R+++ql +g w++vdvS+d   ++++          ++++lpSg+++++++
  TRIDC6AG039350.4 404 KATILEEVSNGiggsrnGALLLMKAELQVLSPLVPiREVIFLRFCKQLAEGAWAVVDVSIDGLLSNQNsattsAGANLKCRRLPSGCVMQDTP 496
                       *************************************************************88777776654222358*************** PP

                       TCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 159 nghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                       ng++kvtwveh++++++++h+ +r+l++sgla+ga++w+atlqrqce+
  TRIDC6AG039350.4 497 NGYCKVTWVEHTEYDEASVHQFYRPLLRSGLAFGASRWLATLQRQCEC 544
                       **********************************************96 PP

Sequence ? help Back to Top
Protein Sequence    Length: 804 aa     Download sequence    
MSFGGLFDGG GGGGGMQFPY AGAFSSSPAL SLGLDNAGGR DGGIGGRMFA DGAGGAMARD  60
AEAQNDSRSG SDHLDAISGV GDDDDDAEPS GSNPRKRKKR YHRHTPQQIQ ELEALFKECP  120
HPDEKQRAEL SKRLSLDARQ VKFWFQNRRT QMKTQLERHE NALLKQENEK LRTENLTIRE  180
AMRTPMCGGC GSPAMLGEVS LEEQHLRIEN ARLKDELNRV CTLATKFLGK PVSLLSPLQL  240
QPHLSMPLPN SSLELAVGGI GGIGSMQPSM HGMMSEYAGG ASSSMGTVIT PARATGSALA  300
SMVDIDRSVF LELAISAMDE LVKMAQTDDP LWVTGLPGFP DKESLNFEEY LHSSQHCIGM  360
KPVGFVSEAS RESGLVIIDN SVALVETLMD ERRWSDMFSC MIAKATILEE VSNGIGGSRN  420
GALLLMKAEL QVLSPLVPIR EVIFLRFCKQ LAEGAWAVVD VSIDGLLSNQ NSATTSAGAN  480
LKCRRLPSGC VMQDTPNGYC KVTWVEHTEY DEASVHQFYR PLLRSGLAFG ASRWLATLQR  540
QCECLAILMS SATVSPNEPT AISQEGKRSM LKLARRMTEN FCAGVSASSA REWSKLDGAT  600
GSIGEDVRVM ARKSVSEPGE PPGVVLSAAT SVWVPIAPEK LFDFLRDEQL RAEWDILSNG  660
GPMQEMARIA KGHQNGNSVS LLRASAMSAN QSSMLILQET CTDASGSIVV YAPVDIPAMQ  720
LVMNGGDSTY VALLPSGFAI LPDGPSIGSE HKTGGSLLTV AFQILVNSQP TAKLTVESVE  780
TVNNLISCTI KKIKTALQCA TPEC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
194100PRKRKKR
29599RKRKK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein