PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC5BG052670.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 751aa    MW: 81687.1 Da    PI: 6.3458
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC5BG052670.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.23.3e-1974128256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         R+++t  q+++Le+++++ r+p++++r eL++++gL+ +qV++WFqNrR   k
  TRIDC5BG052670.2  74 HFRRRHTVAQIQILEAAYQEGRHPDEKRRLELSRRTGLSPTQVQIWFQNRRNSGK 128
                       5699***********************************************7655 PP

2START110.42.7e-352504665204
                       HHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.....SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEE CS
             START   5 eaaqelvkkalaeepgWvkss....esengdevlqkfeeskv....dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevi 85 
                       +a++el  +a++++p+W++      e  n++e+++   +++     +  ea r +g+  +++++lv +l++    W++t++    +a+t + i
  TRIDC5BG052670.2 250 CAMEELKVLAGLGAPLWSLAEggevEVINYKEYMKMMFPNERhemeFCAEATRKTGIISCTATDLVGILMNAD-WWSQTFPgivaSATTSKII 341
                       789999999************9988777888888887776667899999************************.**********9******** PP

                       CTT....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE- CS
             START  86 ssg....galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksnghskvtwvehvdl 172
                       ++g    g +qlm+ael +lsp vp R+  f+R +++  + +wv+vdvSvd  +++    s +  ++l pSg+ i+++ ngh++vtw+ ++  
  TRIDC5BG052670.2 342 TPGdsgdGLVQLMSAELRVLSPRVPvRKINFIRRCQKIAENTWVVVDVSVDGIRDQDGaPSTYTACKLQPSGCHIQELNNGHCQVTWIVNMAH 434
                       ***************************************************99998888899******************************* PP

                       -SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXX CS
             START 173 kgrlphwllrslvksglaegaktwvatlqrqc 204
                       ++++++ l ++l +sg a ga +w a lqr c
  TRIDC5BG052670.2 435 DEATVPPLHHPLFRSGWALGACRWIASLQRRC 466
                       *****************************998 PP

Sequence ? help Back to Top
Protein Sequence    Length: 751 aa     Download sequence    
MDGEWPEQNS YLYDWLVLGY PGGDNHVIQP DLGAEVNGLP GAAANMGNNT NAAAADQGNG  60
GGQANGDQRA GTRHFRRRHT VAQIQILEAA YQEGRHPDEK RRLELSRRTG LSPTQVQIWF  120
QNRRNSGKSK AQQKETEEFQ EENGRLQAEK QALMSALQNR LCITCRGEDT LERQRLYAEN  180
VMLKDAHKRI ADYLKNVSGG RLQVMNHTVV DTHAPFTLTA PNPVMIPDEG VARDDPETNG  240
NTLVVQHVAC AMEELKVLAG LGAPLWSLAE GGEVEVINYK EYMKMMFPNE RHEMEFCAEA  300
TRKTGIISCT ATDLVGILMN ADWWSQTFPG IVASATTSKI ITPGDSGDGL VQLMSAELRV  360
LSPRVPVRKI NFIRRCQKIA ENTWVVVDVS VDGIRDQDGA PSTYTACKLQ PSGCHIQELN  420
NGHCQVTWIV NMAHDEATVP PLHHPLFRSG WALGACRWIA SLQRRCDYIA SLHTNPVLTL  480
NTRSGGVAPI TPEGRKSVLE VAHRMTLKFY EAICGPGTQP WTSVDERRGS CGVGAERFEV  540
DVGVVTFPVG TTGATVLRAT TTVWLPGTPA QRVFNYLCDG DRRTEWDIGA NRTSTIRQEG  600
SFSTGQLDGN SVSLLRTIAS NGAYGKLFLQ ESCIDASCMV LAYAPIDDQT IQDVINGTHT  660
SFSLLPSGVV VLPDGNAEPG APSTSAMCSS SSSAGHRSNS GSLVSTMYQT LLSGQPPEHL  720
FKAVAENVGN LLCQAIDKIK SGVHANVVLA A
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.11e-112HD-ZIP family protein