PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC5BG050750.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 249aa    MW: 27502.6 Da    PI: 4.7583
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC5BG050750.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox611.8e-192779456
                      -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                      + +f++eq++ Le++F+ + ++  +++ +LA++lgL+ rqV +WFqN+Ra++k
  TRIDC5BG050750.2 27 KKRFSEEQIKSLESMFATQTKLEPRQKLQLARELGLQPRQVAIWFQNKRARWK 79
                      456*************************************************9 PP

2HD-ZIP_I/II122.91.6e-3926117293
       HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                       +k+r+s+eq+k+LE++F +++kLep++K +lareLglqprqva+WFqn+RAR+k+kqlE++y+aL++ ydal ++ ++L+k++++L ++l++
  TRIDC5BG050750.2  26 RKKRFSEEQIKSLESMFATQTKLEPRQKLQLARELGLQPRQVAIWFQNKRARWKSKQLERQYAALRDDYDALLSSYDQLKKDKQALVNQLEK 117
                       8***************************************************************************************9986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    
MEQGEEDGDW MMEPAAGKKG GVMIDRKKRF SEEQIKSLES MFATQTKLEP RQKLQLAREL  60
GLQPRQVAIW FQNKRARWKS KQLERQYAAL RDDYDALLSS YDQLKKDKQA LVNQLEKLAE  120
MLREPGGAKC GDNAGAAARD DVRLAVAGMS MKDEFVDAGG ASKLYSASEG CGGSGKLSLF  180
GEDDDDAGLF LRPSLQLPTA HDGGFTASGP AEYQQQSPSS FPFHSSWPSS AAEQTCSSSQ  240
WWEFESPSE
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.18e-43HD-ZIP family protein