PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC5BG050400.6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 788aa    MW: 84786.9 Da    PI: 5.8511
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC5BG050400.6genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.41.9e-2160115156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++eLe++F+++++p++++r eL+++l+L+ rqVk+WFqNrR+++k
  TRIDC5BG050400.6  60 KKRYHRHTPQQIQELEAVFKECPHPDEKQRMELSRRLNLESRQVKFWFQNRRTQMK 115
                       688999***********************************************999 PP

2START169.32.5e-532724984205
                       HHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEE CS
             START   4 eeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                       ++a++elvk  ++++p+W  s     e +n de+++ f++  +     + +ea r++g+ + ++++lv++l++  ++W+e+++    +a+t+e
  TRIDC5BG050400.6 272 LAAMEELVKVTQVDDPLWQPSLdiglETLNFDEYRRAFARVLGpspagYVSEATREVGIAIINSVDLVNSLMNEVPRWSEMFPcvvaRASTME 364
                       789*******************9***************88666************************************************** PP

                       EECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--......-TTSEE-EESSEEEEEEEECTCEEEE CS
             START  84 vissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.....sssvvRaellpSgiliepksnghskv 164
                        is g      g +qlm aelq+lsplvp R+++f+R+++q+ +g w+ivdvSvd    p +      ++++ ++llpSg+++e+++ng+ kv
  TRIDC5BG050400.6 365 IISCGmggtrsGSIQLMRAELQVLSPLVPiREVTFLRFCKQHADGLWAIVDVSVDGVLRPDSgtgagPAGYMGCRLLPSGCIVEDMQNGYAKV 457
                       *******************************************************99888877778789************************ PP

                       EEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
             START 165 twvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                       twv h++++++ +h+l+r+l++sg+a ga++w+a lqrqce
  TRIDC5BG050400.6 458 TWVVHAEYDEAAVHELYRPLLRSGQALGARRWLASLQRQCE 498
                       ****************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 788 aa     Download sequence    
MEGGGQLGGA FMGSTGSGGD GDSLGRARED ENDSRSGSDN LDGASADELD PDNSNPRKKK  60
KRYHRHTPQQ IQELEAVFKE CPHPDEKQRM ELSRRLNLES RQVKFWFQNR RTQMKTQIER  120
HENALLRQEN DKLRTENMTI REAMRSPTCG NCGGAAVLGE VSLEEQHLRI ENSRLKDELD  180
RVCALAGKFL GRPVSAISSP LSLPSSLCSG LDLAVGSNNG FMGMGMQSIP DLMGGGSAAM  240
RLPAGIMGGG LDDGLGGDGG AIDRGALLEL GLAAMEELVK VTQVDDPLWQ PSLDIGLETL  300
NFDEYRRAFA RVLGPSPAGY VSEATREVGI AIINSVDLVN SLMNEVPRWS EMFPCVVARA  360
STMEIISCGM GGTRSGSIQL MRAELQVLSP LVPIREVTFL RFCKQHADGL WAIVDVSVDG  420
VLRPDSGTGA GPAGYMGCRL LPSGCIVEDM QNGYAKVTWV VHAEYDEAAV HELYRPLLRS  480
GQALGARRWL ASLQRQCEYH AILCSNPHPN HGDRHEAISP AGRRCMLRLA QRMADNFCAG  540
VCATAAQKWR RLDEWRVEGA GGRDPAGGED KVRMMARQSV GAPGEPPGVV LSATTSVRLP  600
GTLPQRVFDY LRDEQRRGEW DILANGEAMQ EMDHIAKGQH HGNAVSLLRP NATSGNQNNM  660
LILQETCTDA SGSLVVYAPV DVQSMHVVMG GGDSAYVSLL PSGFAILPDG HTTPATATDP  720
SPQGSSPNAH AGSSNNNPGS LVTVAFQILV NNLPTAKLTV ESVDTVSNLL SCTIQKIKSA  780
LQASIISP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15762RKKKKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein