PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC5BG050400.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 777aa    MW: 83924 Da    PI: 5.8702
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC5BG050400.5genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.41.8e-2168123156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++eLe++F+++++p++++r eL+++l+L+ rqVk+WFqNrR+++k
  TRIDC5BG050400.5  68 KKRYHRHTPQQIQELEAVFKECPHPDEKQRMELSRRLNLESRQVKFWFQNRRTQMK 123
                       688999***********************************************999 PP

2START1693.3e-532805054205
                       HHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEE CS
             START   4 eeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                       ++a++elvk  ++++p+W  s     e +n de+++ f++  +     + +ea r++g+ + ++++lv++l++   +W+e+++    +a+t+e
  TRIDC5BG050400.5 280 LAAMEELVKVTQVDDPLWQPSLdiglETLNFDEYRRAFARVLGpspagYVSEATREVGIAIINSVDLVNSLMNEV-RWSEMFPcvvaRASTME 371
                       789*******************9***************88666********************************.***************** PP

                       EECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--......-TTSEE-EESSEEEEEEEECTCEEEE CS
             START  84 vissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.....sssvvRaellpSgiliepksnghskv 164
                        is g      g +qlm aelq+lsplvp R+++f+R+++q+ +g w+ivdvSvd    p +      ++++ ++llpSg+++e+++ng+ kv
  TRIDC5BG050400.5 372 IISCGmggtrsGSIQLMRAELQVLSPLVPiREVTFLRFCKQHADGLWAIVDVSVDGVLRPDSgtgagPAGYMGCRLLPSGCIVEDMQNGYAKV 464
                       *******************************************************99888877778789************************ PP

                       EEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
             START 165 twvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                       twv h++++++ +h+l+r+l++sg+a ga++w+a lqrqce
  TRIDC5BG050400.5 465 TWVVHAEYDEAAVHELYRPLLRSGQALGARRWLASLQRQCE 505
                       ****************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 777 aa     Download sequence    
SAWYAQTNME GGGQLGGAFM GSTGSGGDGD SLGRAREDEN DSRSGSDNLD GASADELDPD  60
NSNPRKKKKR YHRHTPQQIQ ELEAVFKECP HPDEKQRMEL SRRLNLESRQ VKFWFQNRRT  120
QMKTQIERHE NALLRQENDK LRTENMTIRE AMRSPTCGNC GGAAVLGEVS LEEQHLRIEN  180
SRLKDELDRV CALAGKFLGR PVSAISSPLS LPSSLCSGLD LAVGSNNGFM GMGMQSIPDL  240
MGGGSAAMRL PAGIMGGGLD DGLGGDGGAI DRGALLELGL AAMEELVKVT QVDDPLWQPS  300
LDIGLETLNF DEYRRAFARV LGPSPAGYVS EATREVGIAI INSVDLVNSL MNEVRWSEMF  360
PCVVARASTM EIISCGMGGT RSGSIQLMRA ELQVLSPLVP IREVTFLRFC KQHADGLWAI  420
VDVSVDGVLR PDSGTGAGPA GYMGCRLLPS GCIVEDMQNG YAKVTWVVHA EYDEAAVHEL  480
YRPLLRSGQA LGARRWLASL QRQCEYHAIL CSNPHPNHGD RHEAISPAGR RCMLRLAQRM  540
ADNFCAGVCA TAAQKWRRLD EWRVEGAGGR DPAGGEDKVR MMARQSVGAP GEPPGVVLSA  600
TTSVRLPGTL PQRVFDYLRD EQRRGEWDIL ANGEAMQEMD HIAKGQHHGN AVSLLRPNAT  660
SGNQNNMLIL QETCTDASGS LVVYAPVDVQ SMHVVMGGGD SAYVSLLPSG FAILPDGHTT  720
GSSNNNPGSL VTVAFQILVN NLPTAKLTVE SVDTVSNLLS CTIQKIKSAL QASIISP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16570RKKKKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein