PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC5BG050400.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 774aa    MW: 83600.5 Da    PI: 5.7594
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC5BG050400.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.41.8e-2166121156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++eLe++F+++++p++++r eL+++l+L+ rqVk+WFqNrR+++k
  TRIDC5BG050400.2  66 KKRYHRHTPQQIQELEAVFKECPHPDEKQRMELSRRLNLESRQVKFWFQNRRTQMK 121
                       688999***********************************************999 PP

2START1693.2e-532785034205
                       HHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEE CS
             START   4 eeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                       ++a++elvk  ++++p+W  s     e +n de+++ f++  +     + +ea r++g+ + ++++lv++l++   +W+e+++    +a+t+e
  TRIDC5BG050400.2 278 LAAMEELVKVTQVDDPLWQPSLdiglETLNFDEYRRAFARVLGpspagYVSEATREVGIAIINSVDLVNSLMNEV-RWSEMFPcvvaRASTME 369
                       789*******************9***************88666********************************.***************** PP

                       EECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--......-TTSEE-EESSEEEEEEEECTCEEEE CS
             START  84 vissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.....sssvvRaellpSgiliepksnghskv 164
                        is g      g +qlm aelq+lsplvp R+++f+R+++q+ +g w+ivdvSvd    p +      ++++ ++llpSg+++e+++ng+ kv
  TRIDC5BG050400.2 370 IISCGmggtrsGSIQLMRAELQVLSPLVPiREVTFLRFCKQHADGLWAIVDVSVDGVLRPDSgtgagPAGYMGCRLLPSGCIVEDMQNGYAKV 462
                       *******************************************************99888877778789************************ PP

                       EEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
             START 165 twvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                       twv h++++++ +h+l+r+l++sg+a ga++w+a lqrqce
  TRIDC5BG050400.2 463 TWVVHAEYDEAAVHELYRPLLRSGQALGARRWLASLQRQCE 503
                       ****************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 774 aa     Download sequence    
WYAQTNMEGG GQLGGAFMGS TGSGGDGDSL GRAREDENDS RSGSDNLDGA SADELDPDNS  60
NPRKKKKRYH RHTPQQIQEL EAVFKECPHP DEKQRMELSR RLNLESRQVK FWFQNRRTQM  120
KTQIERHENA LLRQENDKLR TENMTIREAM RSPTCGNCGG AAVLGEVSLE EQHLRIENSR  180
LKDELDRVCA LAGKFLGRPV SAISSPLSLP SSLCSGLDLA VGSNNGFMGM GMQSIPDLMG  240
GGSAAMRLPA GIMGGGLDDG LGGDGGAIDR GALLELGLAA MEELVKVTQV DDPLWQPSLD  300
IGLETLNFDE YRRAFARVLG PSPAGYVSEA TREVGIAIIN SVDLVNSLMN EVRWSEMFPC  360
VVARASTMEI ISCGMGGTRS GSIQLMRAEL QVLSPLVPIR EVTFLRFCKQ HADGLWAIVD  420
VSVDGVLRPD SGTGAGPAGY MGCRLLPSGC IVEDMQNGYA KVTWVVHAEY DEAAVHELYR  480
PLLRSGQALG ARRWLASLQR QCEYHAILCS NPHPNHGDRH EAISPAGRRC MLRLAQRMAD  540
NFCAGVCATA AQKWRRLDEW RVEGAGGRDP AGGEDKVRMM ARQSVGAPGE PPGVVLSATT  600
SVRLPGTLPQ RVFDYLRDEQ RRGEWDILAN GEAMQEMDHI AKGQHHGNAV SLLRPNATSG  660
NQNNMLILQE TCTDASGSLV VYAPVDVQSM HVVMGGGDSA YVSLLPSGFA ILPDGHTTAG  720
SSNNNPGSLV TVAFQILVNN LPTAKLTVES VDTVSNLLSC TIQKIKSALQ CGDG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16368RKKKKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein