PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC5BG041090.8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 253aa    MW: 27329.2 Da    PI: 4.3378
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC5BG041090.8genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.42.9e-193689356
                      --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                      k++++++eq+++Le+ Fe ++++  e++++LA+ lgL+ rqV vWFqNrRa++k
  TRIDC5BG041090.8 36 KKRRLSAEQVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWK 89
                      45689************************************************9 PP

2HD-ZIP_I/II1345.3e-4335127193
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                       ekkrrls+eqv++LE+sFe e+kLeperK++lar+LglqprqvavWFqnrRAR+ktkqlE+dy+aL+++ydal+ ++++L++++e+L +e+k+
  TRIDC5BG041090.8  35 EKKRRLSAEQVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKQLERDYNALRHSYDALRVDHDALRRDKEALLAEIKD 127
                       69**************************************************************************************99986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    
MVNYMDYGVV GMEADGDAEE EMMACGGGGG CGGGEKKRRL SAEQVRALER SFEVENKLEP  60
ERKARLARDL GLQPRQVAVW FQNRRARWKT KQLERDYNAL RHSYDALRVD HDALRRDKEA  120
LLAEIKDLKG KLGDEEAAAS FTSVKEEPAA SDGPPPAGMG SSDSDSSGVL NDTDATGATP  180
TEEAPAPEMG TLLGGPGAAG AAAAGHGQMF LHGNFLKVEE DETGFLDDEE PCGGFFADEP  240
PLAWWTEPTD PWK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16167ERKARLA
28492RRARWKTKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65310.22e-43HD-ZIP family protein