PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC5BG041090.7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 267aa    MW: 28638.6 Da    PI: 4.4653
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC5BG041090.7genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.23.2e-1950103356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k++++++eq+++Le+ Fe ++++  e++++LA+ lgL+ rqV vWFqNrRa++k
  TRIDC5BG041090.7  50 KKRRLSAEQVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWK 103
                       45689************************************************9 PP

2HD-ZIP_I/II133.86e-4349141193
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                       ekkrrls+eqv++LE+sFe e+kLeperK++lar+LglqprqvavWFqnrRAR+ktkqlE+dy+aL+++ydal+ ++++L++++e+L +e+k+
  TRIDC5BG041090.7  49 EKKRRLSAEQVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKQLERDYNALRHSYDALRVDHDALRRDKEALLAEIKD 141
                       69**************************************************************************************99986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    
MKRPGGGNPS SLHQMASPND YGVVGMEADG DAEEEMMACG GGGGCGGGEK KRRLSAEQVR  60
ALERSFEVEN KLEPERKARL ARDLGLQPRQ VAVWFQNRRA RWKTKQLERD YNALRHSYDA  120
LRVDHDALRR DKEALLAEIK DLKGKLGDEE AAASFTSVKE EPAASDGPPP AGMGSSDSDS  180
SGVLNDTDAT GATPTEEAPA PEMGTLLGGP GAAGAAAAGH GQMFLHGNFL KVEEDETGFL  240
DDEEPCGGFF ADEPPLAWWT EPTDPWK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17581ERKARLA
298106RRARWKTKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65310.23e-43HD-ZIP family protein