PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC5BG041090.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 207aa    MW: 22287.8 Da    PI: 4.9393
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC5BG041090.4genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.82.1e-1951104356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k++++++eq+++Le+ Fe ++++  e++++LA+ lgL+ rqV vWFqNrRa++k
  TRIDC5BG041090.4  51 KKRRLSAEQVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWK 104
                       45689************************************************9 PP

2HD-ZIP_I/II134.63.4e-4350142193
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                       ekkrrls+eqv++LE+sFe e+kLeperK++lar+LglqprqvavWFqnrRAR+ktkqlE+dy+aL+++ydal+ ++++L++++e+L +e+k+
  TRIDC5BG041090.4  50 EKKRRLSAEQVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKQLERDYNALRHSYDALRVDHDALRRDKEALLAEIKD 142
                       69**************************************************************************************99986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    
VELAMKRPGG GNPSSLHQMA SPNGKLMEAD GDAEEEMMAC GGGGGCGGGE KKRRLSAEQV  60
RALERSFEVE NKLEPERKAR LARDLGLQPR QVAVWFQNRR ARWKTKQLER DYNALRHSYD  120
ALRVDHDALR RDKEALLAEI KDLKGKLGDE EAAASFTSVK EEPAASDGPP PAGMGSSDSD  180
SSGVLNDTDA TGATPTEEAP APEMGTL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17682ERKARLA
299107RRARWKTKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65310.22e-44HD-ZIP family protein