PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC5BG038900.6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 94aa    MW: 10610.2 Da    PI: 11.6006
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC5BG038900.6genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.74.7e-191264254
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRak 54
                      rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+
  TRIDC5BG038900.6 12 RKKLRLSKEQAAFLEESFKEHSTLNPRQKVALAKQLNLRPRQVEVWFQNRRAR 64
                      788899**********************************************9 PP

2HD-ZIP_I/II872.5e-281265154
       HD-ZIP_I/II  1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARt 54
                      +kk+rlskeq+++LEesF+e+++L+p++Kv+la++L+l+prqv+vWFqnrRAR 
  TRIDC5BG038900.6 12 RKKLRLSKEQAAFLEESFKEHSTLNPRQKVALAKQLNLRPRQVEVWFQNRRARC 65
                      69***************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 94 aa     Download sequence    
RGSDEDDGGS ARKKLRLSKE QAAFLEESFK EHSTLNPRQK VALAKQLNLR PRQVEVWFQN  60
RRARCGAMKS FSFPSPLSLS SRARILAGQA KPIK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.18e-33HD-ZIP family protein