PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC5BG038900.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 361aa    MW: 38064.1 Da    PI: 12.2664
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC5BG038900.5genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox37.73.6e-122032322756
                       HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox  27 aeereeLAkklgLterqVkvWFqNrRakek 56 
                       ++++  LAk+l+L  rqV vWFqNrRa+ k
  TRIDC5BG038900.5 203 RKQKVALAKQLNLRPRQVEVWFQNRRARTK 232
                       567889**********************98 PP

2HD-ZIP_I/II92.74e-302032682692
       HD-ZIP_I/II  26 perKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                        ++Kv+la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
  TRIDC5BG038900.5 203 RKQKVALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKELAELR-ALK 268
                       489***********************************************************9.555 PP

Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    
GAGVELGGGH GGRRPGAGSW ARGRPGGEEG GGGEEGPGCH RRRRQEGARV GVRLFAGADD  60
AAHASAHGAQ PRLPVAVREQ SDLLRRAFGG VDAGVRREPG AVLRGLGLGR LHGGGGGGGR  120
AGGHRRGSAG GRLVLAQRQR GLLPDGLLRA GRPRRQRRRP GRRRLPRQRR RRRRLGAQEA  180
APLQGAGRVP GGELQGAQHP QPRKQKVALA KQLNLRPRQV EVWFQNRRAR TKLKQTEVDC  240
EYLKRCCETL TEENRRLQKE LAELRALKTV HPFYMHLPAT TLSMCPSCER VASNSAPGTA  300
AAPSPAPASA APAPASGAGI GAAAAPEQHR PSSFAALFSS ARSFPLASSQ PQAPLPAPSS  360
S
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1154159RRQRRR
2157174RRRPGRRRLPRQRRRRRR
3157175RRRPGRRRLPRQRRRRRRL
4158176RRRPGRRRLPRQRRRRRRL
5161168GRRRLPRQ
6167174RQRRRRRR
7168174QRRRRRR
8169174RRRRRR
9227235RRARTKLKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-51HD-ZIP family protein