PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC5BG038900.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 328aa    MW: 35883 Da    PI: 12.4652
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC5BG038900.3genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox37.83.2e-121872162756
                       HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox  27 aeereeLAkklgLterqVkvWFqNrRakek 56 
                       ++++  LAk+l+L  rqV vWFqNrRa+ k
  TRIDC5BG038900.3 187 RKQKVALAKQLNLRPRQVEVWFQNRRARTK 216
                       567889**********************98 PP

2HD-ZIP_I/II933.4e-301872522692
       HD-ZIP_I/II  26 perKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                        ++Kv+la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
  TRIDC5BG038900.3 187 RKQKVALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKELAELR-ALK 252
                       489***********************************************************9.555 PP

Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    
GGRRPGAGSW ARGRPGGEEG GGGEEGPGCH RRRRQEGARV GVRLFAGADD AAHASAHGAQ  60
PRLPVAVREQ AFGGVDAGVR REPGAVLRGL GLGRLHGGGG GGGRAGGHRR GSAGGRLVLA  120
QRQRGLLPDG LLRAGRPRRQ RRRPGRRRLP RQRRRRRRLG AQEAAPLQGA GRVPGGELQG  180
AQHPQPRKQK VALAKQLNLR PRQVEVWFQN RRARTKLKQT EVDCEYLKRC CETLTEENRR  240
LQKELAELRA LKTVHPFYMH LPATTLSMCP SCERVASNSA PGTAAALGRQ PLRSSTGPRR  300
SPRCSRRPGA SRWPRPSPKL HCRRRRAR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1138143RRQRRR
2141158RRRPGRRRLPRQRRRRRR
3141159RRRPGRRRLPRQRRRRRRL
4142160RRRPGRRRLPRQRRRRRRL
5145152GRRRLPRQ
6151158RQRRRRRR
7152158QRRRRRR
8153158RRRRRR
9211219RRARTKLKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.14e-55HD-ZIP family protein