PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC5BG038900.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 284aa    MW: 30427.9 Da    PI: 12.3893
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC5BG038900.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox38.12.6e-121261552756
                       HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox  27 aeereeLAkklgLterqVkvWFqNrRakek 56 
                       ++++  LAk+l+L  rqV vWFqNrRa+ k
  TRIDC5BG038900.2 126 RKQKVALAKQLNLRPRQVEVWFQNRRARTK 155
                       567889**********************98 PP

2HD-ZIP_I/II93.32.6e-301261912692
       HD-ZIP_I/II  26 perKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                        ++Kv+la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
  TRIDC5BG038900.2 126 RKQKVALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKELAELR-ALK 191
                       489***********************************************************9.555 PP

Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    
MGRSDLLRRA FGGVDAGVRR EPGAVLRGLG LGRLHGGGGG GGRAGGHRRG SAGGRLVLAQ  60
RQRGLLPDGL LRAGRPRRQR RRPGRRRLPR QRRRRRRLGA QEAAPLQGAG RVPGGELQGA  120
QHPQPRKQKV ALAKQLNLRP RQVEVWFQNR RARTKLKQTE VDCEYLKRCC ETLTEENRRL  180
QKELAELRAL KTVHPFYMHL PATTLSMCPS CERVASNSAP GTAAAPSPAP ASAAPAPASG  240
AGIGAAAAPE QHRPSSFAAL FSSARSFPLA SSQPQAPLPA PSSS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17782RRQRRR
28097RRRPGRRRLPRQRRRRRR
38098RRRPGRRRLPRQRRRRRRL
48199RRRPGRRRLPRQRRRRRRL
58491GRRRLPRQ
69097RQRRRRRR
79197QRRRRRR
89297RRRRRR
9150158RRARTKLKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-52HD-ZIP family protein