PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC5BG038250.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family ZF-HD
Protein Properties Length: 92aa    MW: 10110.3 Da    PI: 7.6631
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC5BG038250.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer932.6e-291876160
       ZF-HD_dimer  1 kekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                      +++vrY eC++NhAas+Gg+avDGC+Ef+++ geegt  alkC+ACgCHR+FH r +++e
  TRIDC5BG038250.1 18 CCGVRYGECRRNHAASTGGYAVDGCREFIAE-GEEGTLGALKCSACGCHRSFHHRVQVYE 76
                      5789**************************8.999********************99876 PP

Sequence ? help Back to Top
Protein Sequence    Length: 92 aa     Download sequence    
MKRLVVLRRC EPIVRFSCCG VRYGECRRNH AASTGGYAVD GCREFIAEGE EGTLGALKCS  60
ACGCHRSFHH RVQVYEVAWD CESDTSSSSS SS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.11e-26ZF-HD family protein