PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | TRIDC5AG073970.3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 69aa MW: 8038.36 Da PI: 11.6125 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 80.5 | 1.1e-25 | 14 | 63 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rie+ + rqv fskRr g++KKA+EL LCdaeva+++fs+ g+lyey+s TRIDC5AG073970.3 14 RIEDRTSRQVRFSKRRSGLFKKAFELGLLCDAEVALLVFSPAGRLYEYAS 63 8***********************************************86 PP |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 69 aa Download sequence |
RRAMARRGPV ELRRIEDRTS RQVRFSKRRS GLFKKAFELG LLCDAEVALL VFSPAGRLYE 60 YASSRYMQA |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G11880.1 | 2e-26 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Ensembl | TRIDC5AG073970.3 |