PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | TRIDC5AG073450.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 59aa MW: 6694.64 Da PI: 9.0084 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 68.4 | 1.6e-21 | 12 | 58 | 1 | 47 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllk 47 +CaaCk+lrr+Ca+dCvlapyfpa++p+++a vh++FGasnv +ll+ TRIDC5AG073450.1 12 RCAACKYLRRRCAHDCVLAPYFPASHPHRYASVHRVFGASNVARLLQ 58 6******************************************9987 PP |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 59 aa Download sequence |
MHEEDQEGGG RRCAACKYLR RRCAHDCVLA PYFPASHPHR YASVHRVFGA SNVARLLQV |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G31320.1 | 8e-23 | LBD family protein |
Link Out ? help Back to Top | |
---|---|
Ensembl | TRIDC5AG073450.1 |