PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC5AG048740.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 757aa    MW: 82436 Da    PI: 6.809
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC5AG048740.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.65.8e-2076130256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         R+++t eq+++Le++F++ ++p++++r eL++++gL+ +qV++WFqNrR   k
  TRIDC5AG048740.1  76 HFRRRHTVEQIQILEAAFKEGHHPDEKRRLELSRRTGLSPAQVQIWFQNRRNSGK 130
                       5699***********************************************7655 PP

2START100.72.5e-322524745205
                       HHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.....SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEE CS
             START   5 eaaqelvkkalaeepgWvkss....esengdevlqkfeeskv....dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevi 85 
                       +a++e+  ++++++p+W++      e  n++e+l+   +++     +  +  r +g+  +++++lv +l++    W++t++    +a+t +vi
  TRIDC5AG048740.1 252 CAMEEFKVLVGLGAPVWSLAEggevEVINYKEYLKMMFPNEHhemeFGADGTRKTGIISCTATDLVGILMNAD-WWSQTFPgivaSATTSKVI 343
                       7899999999***********888877788888888777666799999999**********************.******************* PP

                       CTT....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.......-TTSEE-EESSEEEEEEEECTCEEEEEEE CS
             START  86 ssg....galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe......sssvvRaellpSgiliepksnghskvtwv 167
                       ++g    g +qlm+ael +lsp vp R+  f+R++++  +  w++vdvSvd  +++         s +  ++l pSg+ i+++sngh++vtw+
  TRIDC5AG048740.1 344 TPGdsgdGMVQLMNAELRVLSPRVPvRKINFIRHCQKIAENIWAVVDVSVDGIRDQAAglndgaPSTYTACKLQPSGCHIQELSNGHCQVTWI 436
                       **************************************************988887666666767899************************* PP

                       E-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
             START 168 ehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                        ++  ++++++ l ++l +sg a ga +w a lqr ce
  TRIDC5AG048740.1 437 VNMVHDEATVPPLHHPLFRSGWALGACRWIASLQRRCE 474
                       ***********************************998 PP

Sequence ? help Back to Top
Protein Sequence    Length: 757 aa     Download sequence    
MDGEWPEQYN DLYNWLGLGY PGGDNQVIQH NLGAEVNGLP GAAANMGNNT NAAAADQGNG  60
GGQANGDQTA GTRERHFRRR HTVEQIQILE AAFKEGHHPD EKRRLELSRR TGLSPAQVQI  120
WFQNRRNSGK SKAQKKETEE FQQENDRLQA EKQALMSAMQ NKICIICRGE DTPERQRLYA  180
ENMMLKDAHM RIADFLKNVS GGRLQVINHT VVDTHAPLTL TGPNPVTIPD HGIARDNPET  240
EGNALAIQHV ACAMEEFKVL VGLGAPVWSL AEGGEVEVIN YKEYLKMMFP NEHHEMEFGA  300
DGTRKTGIIS CTATDLVGIL MNADWWSQTF PGIVASATTS KVITPGDSGD GMVQLMNAEL  360
RVLSPRVPVR KINFIRHCQK IAENIWAVVD VSVDGIRDQA AGLNDGAPST YTACKLQPSG  420
CHIQELSNGH CQVTWIVNMV HDEATVPPLH HPLFRSGWAL GACRWIASLQ RRCEYIASLH  480
TNPVHTLNNR SGGAAAITAE GRKNVLEVAH RMTLKFYEAI CGRGSQPGRS VDERRGSCGV  540
GTERYEVAVR VVTFPVGRGV AVLRATTTVW LPRTPAQRVF NYLCDADRRT EWDISAKRTS  600
TIRQEGCFST GEVHGNSASL LRTIASNGAY GKLILQESSI DASCMVLAYA PIDDQSVEEV  660
MNGTNISFSL LPSGVVVLPD GNAEPGAPPT SAMCSSSSSS SHRSNSGSLV STMYQTLLSG  720
QPPEHLFKAV AENVGNLLCQ AIDKIKSGVH ANVVLSA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.11e-112HD-ZIP family protein