PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC5AG046920.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 138aa    MW: 15855.1 Da    PI: 9.8505
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC5AG046920.3genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.65.8e-202779456
                      -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                      + +f++eq++ Le++F+ + ++  +++ +LA++lgL+ rqV +WFqN+Ra++k
  TRIDC5AG046920.3 27 KKRFSEEQIKSLESMFATQTKLEPRQKLQLARELGLQPRQVAIWFQNKRARWK 79
                      456*************************************************9 PP

2HD-ZIP_I/II125.13.3e-4026115291
       HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                       +k+r+s+eq+k+LE++F +++kLep++K +lareLglqprqva+WFqn+RAR+k+kqlE++y+aL++ ydal ++ ++L+k++++L +++
  TRIDC5AG046920.3  26 RKKRFSEEQIKSLESMFATQTKLEPRQKLQLARELGLQPRQVAIWFQNKRARWKSKQLERQYAALRDDYDALLSSYDQLKKDKQALLNQV 115
                       8*************************************************************************************9887 PP

Sequence ? help Back to Top
Protein Sequence    Length: 138 aa     Download sequence    
MEQGEEDGDW MVEPAAGKKG GAMIDRKKRF SEEQIKSLES MFATQTKLEP RQKLQLAREL  60
GLQPRQVAIW FQNKRARWKS KQLERQYAAL RDDYDALLSS YDQLKKDKQA LLNQVCLYST  120
TYQVLVSPCS PAGGGVRR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.12e-41HD-ZIP family protein