PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC5AG046920.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 227aa    MW: 25226.1 Da    PI: 5.0303
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC5AG046920.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.21.6e-19557456
                      -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                      + +f++eq++ Le++F+ + ++  +++ +LA++lgL+ rqV +WFqN+Ra++k
  TRIDC5AG046920.2  5 KKRFSEEQIKSLESMFATQTKLEPRQKLQLARELGLQPRQVAIWFQNKRARWK 57
                      456*************************************************9 PP

2HD-ZIP_I/II122.62e-39495293
       HD-ZIP_I/II  2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93
                      +k+r+s+eq+k+LE++F +++kLep++K +lareLglqprqva+WFqn+RAR+k+kqlE++y+aL++ ydal ++ ++L+k++++L ++l++
  TRIDC5AG046920.2  4 RKKRFSEEQIKSLESMFATQTKLEPRQKLQLARELGLQPRQVAIWFQNKRARWKSKQLERQYAALRDDYDALLSSYDQLKKDKQALLNQLEK 95
                      8**************************************************************************************99986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    
MIDRKKRFSE EQIKSLESMF ATQTKLEPRQ KLQLARELGL QPRQVAIWFQ NKRARWKSKQ  60
LERQYAALRD DYDALLSSYD QLKKDKQALL NQLEKLAEML REPGGAKCGD NAGAAARDDE  120
RLAVAGMSMK DEFVDAGGAS KLYSASEGCG GSGKLSLFGE EDDDAGLFLR PSLQLPTAHD  180
GGFTASGPAE YQQQSPSSFP FHSSWPSSAA EQTCSSSQWW EFESPSE
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.15e-42HD-ZIP family protein