PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC5AG046620.9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 455aa    MW: 49779.5 Da    PI: 4.985
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC5AG046620.9genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox68.49e-223287156
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                      +++ +++t++q++eLe++F+++++p++++r eL+++l+L+ rqVk+WFqNrR+++k
  TRIDC5AG046620.9 32 KKRYHRHTPQQIQELEAVFKECPHPDEKQRMELSRRLNLESRQVKFWFQNRRTQMK 87
                      688999***********************************************999 PP

2START153.12.4e-482444544190
                       HHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEE CS
             START   4 eeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                       ++a++elvk  ++++p+W  s     e +n de+++ f++  +     + +ea r++g+ + ++++lv++l++ + +W+e+++    +a+t+e
  TRIDC5AG046620.9 244 LAAMEELVKVTQVDDPLWQPSLdiglETLNFDEYRRAFARVLGpspagYVSEATREVGIAIINSVDLVNSLMNEA-RWSEMFPcvvaRASTME 335
                       789*******************9***************88666********************************.***************** PP

                       EECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--......-TTSEE-EESSEEEEEEEECTCEEEE CS
             START  84 vissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.....sssvvRaellpSgiliepksnghskv 164
                        issg      g +qlm aelq+lsplvp R+++f+R+++q+ +g wvivdvSvd    p +      ++++ ++llpSg+++e+++ng+ kv
  TRIDC5AG046620.9 336 IISSGmggtrsGSIQLMRAELQVLSPLVPiREVTFLRFCKQHADGLWVIVDVSVDGVLRPDSgtgagPAGYMGCRLLPSGCIVEDMQNGYAKV 428
                       *******************************************************99888877778789************************ PP

                       EEEE-EE--SSXXHHHHHHHHHHHHH CS
             START 165 twvehvdlkgrlphwllrslvksgla 190
                       twv h++++++ +h+l+r+l++sg+a
  TRIDC5AG046620.9 429 TWVVHAEYDEAAVHELYRPLLRSGQA 454
                       **********************9986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 455 aa     Download sequence    
EDENDSRSGS DNLDGASADE LDPDNSNPRK KKKRYHRHTP QQIQELEAVF KECPHPDEKQ  60
RMELSRRLNL ESRQVKFWFQ NRRTQMKTQI ERHENALLRQ ENDKLRTENM TIREAMRSPT  120
CGNCGGAAVL GEVSLEEQHL RIENSRLKDE LDRVCALAGK FLGRPVSAIS SPLSLPSSLC  180
SGLDLAVGSN NGFMGMGMQS IPDLMGGGSA AMRLPAGIMG GGLDDGLGGE GVAIDRGALL  240
ELGLAAMEEL VKVTQVDDPL WQPSLDIGLE TLNFDEYRRA FARVLGPSPA GYVSEATREV  300
GIAIINSVDL VNSLMNEARW SEMFPCVVAR ASTMEIISSG MGGTRSGSIQ LMRAELQVLS  360
PLVPIREVTF LRFCKQHADG LWVIVDVSVD GVLRPDSGTG AGPAGYMGCR LLPSGCIVED  420
MQNGYAKVTW VVHAEYDEAA VHELYRPLLR SGQAL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12934RKKKKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.11e-172HD-ZIP family protein