PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC5AG046620.8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 859aa    MW: 91683.6 Da    PI: 6.0104
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC5AG046620.8genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.22.1e-21132187156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++eLe++F+++++p++++r eL+++l+L+ rqVk+WFqNrR+++k
  TRIDC5AG046620.8 132 KKRYHRHTPQQIQELEAVFKECPHPDEKQRMELSRRLNLESRQVKFWFQNRRTQMK 187
                       688999***********************************************999 PP

2START172.23.4e-543445694205
                       HHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEE CS
             START   4 eeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                       ++a++elvk  ++++p+W  s     e +n de+++ f++  +     + +ea r++g+ + ++++lv++l++   +W+e+++    +a+t+e
  TRIDC5AG046620.8 344 LAAMEELVKVTQVDDPLWQPSLdiglETLNFDEYRRAFARVLGpspagYVSEATREVGIAIINSVDLVNSLMNEV-RWSEMFPcvvaRASTME 435
                       789*******************9***************88666********************************.***************** PP

                       EECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--......-TTSEE-EESSEEEEEEEECTCEEEE CS
             START  84 vissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.....sssvvRaellpSgiliepksnghskv 164
                        issg      g +qlm aelq+lsplvp R+++f+R+++q+ +g wvivdvSvd    p +      ++++ ++llpSg+++e+++ng+ kv
  TRIDC5AG046620.8 436 IISSGmggtrsGSIQLMRAELQVLSPLVPiREVTFLRFCKQHADGLWVIVDVSVDGVLRPDSgtgagPAGYMGCRLLPSGCIVEDMQNGYAKV 528
                       *******************************************************99888877778789************************ PP

                       EEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
             START 165 twvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                       twv h++++++ +h+l+r+l++sg+a ga++w+a lqrqce
  TRIDC5AG046620.8 529 TWVVHAEYDEAAVHELYRPLLRSGQALGARRWLASLQRQCE 569
                       ****************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 859 aa     Download sequence    
MSFGGMFDGA GSGVFSYDAG GGGPGMHNPG RLLAPPPIPR PGAGAGGGGF ASSTGLSLGL  60
VCYILYYHPQ TNMEGGGQLG GAFMGSTGSG GDGDSLGRAR EDENDSRSGS DNLDGASADE  120
LDPDNSNPRK KKKRYHRHTP QQIQELEAVF KECPHPDEKQ RMELSRRLNL ESRQVKFWFQ  180
NRRTQMKTQI ERHENALLRQ ENDKLRTENM TIREAMRSPT CGNCGGAAVL GEVSLEEQHL  240
RIENSRLKDE LDRVCALAGK FLGRPVSAIS SPLSLPSSLC SGLDLAVGSN NGFMGMGMQS  300
IPDLMGGGSA AMRLPAGIMG GGLDDGLGGE GVAIDRGALL ELGLAAMEEL VKVTQVDDPL  360
WQPSLDIGLE TLNFDEYRRA FARVLGPSPA GYVSEATREV GIAIINSVDL VNSLMNEVRW  420
SEMFPCVVAR ASTMEIISSG MGGTRSGSIQ LMRAELQVLS PLVPIREVTF LRFCKQHADG  480
LWVIVDVSVD GVLRPDSGTG AGPAGYMGCR LLPSGCIVED MQNGYAKVTW VVHAEYDEAA  540
VHELYRPLLR SGQALGARRW LASLQRQCEY HAILCSNPHP NHGDRHEPIS PAGRRCMLRL  600
AQRMADNFCA GVCATAAQKW RRLDEWRVEG AGGRDPAGGE DKVRMMARQS VGAPGEPPGV  660
VLSATTSVRL PGTPPQRVFD YLRDEQRRGE WDILANGEAM QEMDHIAKGQ HHGNAVSLLR  720
PNATSGNQNN MLILQETCTD ASGSLVVYAP VDVQSMHVVM GGGDSAYVSL LPSGFAILPD  780
GHTAPAAATD PSSQGSSPNA HGGSSNNSPG SLVTVAFQIL VNNLPTAKLT VESVDTVSNL  840
LSCTIQKIKS ALQASIISP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1129134RKKKKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein