PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC5AG046620.6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 813aa    MW: 86982.3 Da    PI: 5.9571
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC5AG046620.6genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.31.9e-2186141156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++eLe++F+++++p++++r eL+++l+L+ rqVk+WFqNrR+++k
  TRIDC5AG046620.6  86 KKRYHRHTPQQIQELEAVFKECPHPDEKQRMELSRRLNLESRQVKFWFQNRRTQMK 141
                       688999***********************************************999 PP

2START172.33e-542985234205
                       HHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEE CS
             START   4 eeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                       ++a++elvk  ++++p+W  s     e +n de+++ f++  +     + +ea r++g+ + ++++lv++l++   +W+e+++    +a+t+e
  TRIDC5AG046620.6 298 LAAMEELVKVTQVDDPLWQPSLdiglETLNFDEYRRAFARVLGpspagYVSEATREVGIAIINSVDLVNSLMNEV-RWSEMFPcvvaRASTME 389
                       789*******************9***************88666********************************.***************** PP

                       EECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--......-TTSEE-EESSEEEEEEEECTCEEEE CS
             START  84 vissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.....sssvvRaellpSgiliepksnghskv 164
                        issg      g +qlm aelq+lsplvp R+++f+R+++q+ +g wvivdvSvd    p +      ++++ ++llpSg+++e+++ng+ kv
  TRIDC5AG046620.6 390 IISSGmggtrsGSIQLMRAELQVLSPLVPiREVTFLRFCKQHADGLWVIVDVSVDGVLRPDSgtgagPAGYMGCRLLPSGCIVEDMQNGYAKV 482
                       *******************************************************99888877778789************************ PP

                       EEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
             START 165 twvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                       twv h++++++ +h+l+r+l++sg+a ga++w+a lqrqce
  TRIDC5AG046620.6 483 TWVVHAEYDEAAVHELYRPLLRSGQALGARRWLASLQRQCE 523
                       ****************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 813 aa     Download sequence    
IPRPGAGAGG GGFASSTGLS LGLQTNMEGG GQLGGAFMGS TGSGGDGDSL GRAREDENDS  60
RSGSDNLDGA SADELDPDNS NPRKKKKRYH RHTPQQIQEL EAVFKECPHP DEKQRMELSR  120
RLNLESRQVK FWFQNRRTQM KTQIERHENA LLRQENDKLR TENMTIREAM RSPTCGNCGG  180
AAVLGEVSLE EQHLRIENSR LKDELDRVCA LAGKFLGRPV SAISSPLSLP SSLCSGLDLA  240
VGSNNGFMGM GMQSIPDLMG GGSAAMRLPA GIMGGGLDDG LGGEGVAIDR GALLELGLAA  300
MEELVKVTQV DDPLWQPSLD IGLETLNFDE YRRAFARVLG PSPAGYVSEA TREVGIAIIN  360
SVDLVNSLMN EVRWSEMFPC VVARASTMEI ISSGMGGTRS GSIQLMRAEL QVLSPLVPIR  420
EVTFLRFCKQ HADGLWVIVD VSVDGVLRPD SGTGAGPAGY MGCRLLPSGC IVEDMQNGYA  480
KVTWVVHAEY DEAAVHELYR PLLRSGQALG ARRWLASLQR QCEYHAILCS NPHPNHGDRH  540
EPISPAGRRC MLRLAQRMAD NFCAGVCATA AQKWRRLDEW RVEGAGGRDP AGGEDKVRMM  600
ARQSVGAPGE PPGVVLSATT SVRLPGTPPQ RVFDYLRDEQ RRGEWDILAN GEAMQEMDHI  660
AKGQHHGNAV SLLRPNATSG NQNNMLILQE TCTDASGSLV VYAPVDVQSM HVVMGGGDSA  720
YVSLLPSGFA ILPDGHTAPA AATDPSSQGS SPNAHGGSSN NSPGSLVTVA FQILVNNLPT  780
AKLTVESVDT VSNLLSCTIQ KIKSALQASI ISP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18388RKKKKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein