PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC5AG046620.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 774aa    MW: 83536.6 Da    PI: 5.8711
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC5AG046620.5genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.41.8e-2165120156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++eLe++F+++++p++++r eL+++l+L+ rqVk+WFqNrR+++k
  TRIDC5AG046620.5  65 KKRYHRHTPQQIQELEAVFKECPHPDEKQRMELSRRLNLESRQVKFWFQNRRTQMK 120
                       688999***********************************************999 PP

2START172.52.8e-542775024205
                       HHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEE CS
             START   4 eeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                       ++a++elvk  ++++p+W  s     e +n de+++ f++  +     + +ea r++g+ + ++++lv++l++   +W+e+++    +a+t+e
  TRIDC5AG046620.5 277 LAAMEELVKVTQVDDPLWQPSLdiglETLNFDEYRRAFARVLGpspagYVSEATREVGIAIINSVDLVNSLMNEV-RWSEMFPcvvaRASTME 368
                       789*******************9***************88666********************************.***************** PP

                       EECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--......-TTSEE-EESSEEEEEEEECTCEEEE CS
             START  84 vissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.....sssvvRaellpSgiliepksnghskv 164
                        issg      g +qlm aelq+lsplvp R+++f+R+++q+ +g wvivdvSvd    p +      ++++ ++llpSg+++e+++ng+ kv
  TRIDC5AG046620.5 369 IISSGmggtrsGSIQLMRAELQVLSPLVPiREVTFLRFCKQHADGLWVIVDVSVDGVLRPDSgtgagPAGYMGCRLLPSGCIVEDMQNGYAKV 461
                       *******************************************************99888877778789************************ PP

                       EEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
             START 165 twvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                       twv h++++++ +h+l+r+l++sg+a ga++w+a lqrqce
  TRIDC5AG046620.5 462 TWVVHAEYDEAAVHELYRPLLRSGQALGARRWLASLQRQCE 502
                       ****************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 774 aa     Download sequence    
GLQTNMEGGG QLGGAFMGST GSGGDGDSLG RAREDENDSR SGSDNLDGAS ADELDPDNSN  60
PRKKKKRYHR HTPQQIQELE AVFKECPHPD EKQRMELSRR LNLESRQVKF WFQNRRTQMK  120
TQIERHENAL LRQENDKLRT ENMTIREAMR SPTCGNCGGA AVLGEVSLEE QHLRIENSRL  180
KDELDRVCAL AGKFLGRPVS AISSPLSLPS SLCSGLDLAV GSNNGFMGMG MQSIPDLMGG  240
GSAAMRLPAG IMGGGLDDGL GGEGVAIDRG ALLELGLAAM EELVKVTQVD DPLWQPSLDI  300
GLETLNFDEY RRAFARVLGP SPAGYVSEAT REVGIAIINS VDLVNSLMNE VRWSEMFPCV  360
VARASTMEII SSGMGGTRSG SIQLMRAELQ VLSPLVPIRE VTFLRFCKQH ADGLWVIVDV  420
SVDGVLRPDS GTGAGPAGYM GCRLLPSGCI VEDMQNGYAK VTWVVHAEYD EAAVHELYRP  480
LLRSGQALGA RRWLASLQRQ CEYHAILCSN PHPNHGDRHE PISPAGRRCM LRLAQRMADN  540
FCAGVCATAA QKWRRLDEWR VEGAGGRDPA GGEDKVRMMA RQSVGAPGEP PGVVLSATTS  600
VRLPGTPPQR VFDYLRDEQR RGEWDILANG EAMQEMDHIA KGQHHGNAVS LLRPNATSGN  660
QNNMLILQET CTDASGSLVV YAPVDVQSMH VVMGGGDSAY VSLLPSGFAI LPDGHTAGSS  720
NNSPGSLVTV AFQILVNNLP TAKLTVESVD TVSNLLSCTI QKIKSALQAS IISP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16267RKKKKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein