PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC5AG046620.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 782aa    MW: 84682 Da    PI: 6.0317
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC5AG046620.4genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.41.8e-2175130156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++eLe++F+++++p++++r eL+++l+L+ rqVk+WFqNrR+++k
  TRIDC5AG046620.4  75 KKRYHRHTPQQIQELEAVFKECPHPDEKQRMELSRRLNLESRQVKFWFQNRRTQMK 130
                       688999***********************************************999 PP

2START172.42.8e-542875124205
                       HHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEE CS
             START   4 eeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                       ++a++elvk  ++++p+W  s     e +n de+++ f++  +     + +ea r++g+ + ++++lv++l++   +W+e+++    +a+t+e
  TRIDC5AG046620.4 287 LAAMEELVKVTQVDDPLWQPSLdiglETLNFDEYRRAFARVLGpspagYVSEATREVGIAIINSVDLVNSLMNEV-RWSEMFPcvvaRASTME 378
                       789*******************9***************88666********************************.***************** PP

                       EECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--......-TTSEE-EESSEEEEEEEECTCEEEE CS
             START  84 vissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.....sssvvRaellpSgiliepksnghskv 164
                        issg      g +qlm aelq+lsplvp R+++f+R+++q+ +g wvivdvSvd    p +      ++++ ++llpSg+++e+++ng+ kv
  TRIDC5AG046620.4 379 IISSGmggtrsGSIQLMRAELQVLSPLVPiREVTFLRFCKQHADGLWVIVDVSVDGVLRPDSgtgagPAGYMGCRLLPSGCIVEDMQNGYAKV 471
                       *******************************************************99888877778789************************ PP

                       EEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
             START 165 twvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                       twv h++++++ +h+l+r+l++sg+a ga++w+a lqrqce
  TRIDC5AG046620.4 472 TWVVHAEYDEAAVHELYRPLLRSGQALGARRWLASLQRQCE 512
                       ****************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 782 aa     Download sequence    
VCYILYYHPA VHQTNMEGGG QLGGAFMGST GSGGDGDSLG RAREDENDSR SGSDNLDGAS  60
ADELDPDNSN PRKKKKRYHR HTPQQIQELE AVFKECPHPD EKQRMELSRR LNLESRQVKF  120
WFQNRRTQMK TQIERHENAL LRQENDKLRT ENMTIREAMR SPTCGNCGGA AVLGEVSLEE  180
QHLRIENSRL KDELDRVCAL AGKFLGRPVS AISSPLSLPS SLCSGLDLAV GSNNGFMGMG  240
MQSIPDLMGG GSAAMRLPAG IMGGGLDDGL GGEGVAIDRG ALLELGLAAM EELVKVTQVD  300
DPLWQPSLDI GLETLNFDEY RRAFARVLGP SPAGYVSEAT REVGIAIINS VDLVNSLMNE  360
VRWSEMFPCV VARASTMEII SSGMGGTRSG SIQLMRAELQ VLSPLVPIRE VTFLRFCKQH  420
ADGLWVIVDV SVDGVLRPDS GTGAGPAGYM GCRLLPSGCI VEDMQNGYAK VTWVVHAEYD  480
EAAVHELYRP LLRSGQALGA RRWLASLQRQ CEYHAILCSN PHPNHGDRHE PISPAGRRCM  540
LRLAQRMADN FCAGVCATAA QKWRRLDEWR VEGAGGRDPA GGEDKVRMMA RQSVGAPGEP  600
PGVVLSATTS VRLPGTPPQR VFDYLRDEQR RGEWDILANG EAMQEMDHIA KGQHHGNAVS  660
LLRPNATSGN QNNMLILQET CTDASGSLVV YAPVDVQSMH VVMGGGDSAY VSLLPSGFAI  720
LPDGHTASNN SPGSLVTVAF QILVNNLPTA KLTVESVDTV SNLLSCTIQK IKSALQASII  780
SP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17277RKKKKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein