PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC5AG046620.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 782aa    MW: 84646.8 Da    PI: 6.0321
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC5AG046620.3genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.41.8e-2174129156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++eLe++F+++++p++++r eL+++l+L+ rqVk+WFqNrR+++k
  TRIDC5AG046620.3  74 KKRYHRHTPQQIQELEAVFKECPHPDEKQRMELSRRLNLESRQVKFWFQNRRTQMK 129
                       688999***********************************************999 PP

2START172.42.8e-542865114205
                       HHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEE CS
             START   4 eeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                       ++a++elvk  ++++p+W  s     e +n de+++ f++  +     + +ea r++g+ + ++++lv++l++   +W+e+++    +a+t+e
  TRIDC5AG046620.3 286 LAAMEELVKVTQVDDPLWQPSLdiglETLNFDEYRRAFARVLGpspagYVSEATREVGIAIINSVDLVNSLMNEV-RWSEMFPcvvaRASTME 377
                       789*******************9***************88666********************************.***************** PP

                       EECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--......-TTSEE-EESSEEEEEEEECTCEEEE CS
             START  84 vissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.....sssvvRaellpSgiliepksnghskv 164
                        issg      g +qlm aelq+lsplvp R+++f+R+++q+ +g wvivdvSvd    p +      ++++ ++llpSg+++e+++ng+ kv
  TRIDC5AG046620.3 378 IISSGmggtrsGSIQLMRAELQVLSPLVPiREVTFLRFCKQHADGLWVIVDVSVDGVLRPDSgtgagPAGYMGCRLLPSGCIVEDMQNGYAKV 470
                       *******************************************************99888877778789************************ PP

                       EEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
             START 165 twvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                       twv h++++++ +h+l+r+l++sg+a ga++w+a lqrqce
  TRIDC5AG046620.3 471 TWVVHAEYDEAAVHELYRPLLRSGQALGARRWLASLQRQCE 511
                       ****************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 782 aa     Download sequence    
CYILYYHPAV HQTNMEGGGQ LGGAFMGSTG SGGDGDSLGR AREDENDSRS GSDNLDGASA  60
DELDPDNSNP RKKKKRYHRH TPQQIQELEA VFKECPHPDE KQRMELSRRL NLESRQVKFW  120
FQNRRTQMKT QIERHENALL RQENDKLRTE NMTIREAMRS PTCGNCGGAA VLGEVSLEEQ  180
HLRIENSRLK DELDRVCALA GKFLGRPVSA ISSPLSLPSS LCSGLDLAVG SNNGFMGMGM  240
QSIPDLMGGG SAAMRLPAGI MGGGLDDGLG GEGVAIDRGA LLELGLAAME ELVKVTQVDD  300
PLWQPSLDIG LETLNFDEYR RAFARVLGPS PAGYVSEATR EVGIAIINSV DLVNSLMNEV  360
RWSEMFPCVV ARASTMEIIS SGMGGTRSGS IQLMRAELQV LSPLVPIREV TFLRFCKQHA  420
DGLWVIVDVS VDGVLRPDSG TGAGPAGYMG CRLLPSGCIV EDMQNGYAKV TWVVHAEYDE  480
AAVHELYRPL LRSGQALGAR RWLASLQRQC EYHAILCSNP HPNHGDRHEP ISPAGRRCML  540
RLAQRMADNF CAGVCATAAQ KWRRLDEWRV EGAGGRDPAG GEDKVRMMAR QSVGAPGEPP  600
GVVLSATTSV RLPGTPPQRV FDYLRDEQRR GEWDILANGE AMQEMDHIAK GQHHGNAVSL  660
LRPNATSGNQ NNMLILQETC TDASGSLVVY APVDVQSMHV VMGGGDSAYV SLLPSGFAIL  720
PDGHTAGGSS NNSPGSLVTV AFQILVNNLP TAKLTVESVD TVSNLLSCTI QKIKSALQCG  780
DR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17176RKKKKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein