PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC5AG046620.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 787aa    MW: 85187.5 Da    PI: 6.0321
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC5AG046620.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.41.9e-2179134156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++eLe++F+++++p++++r eL+++l+L+ rqVk+WFqNrR+++k
  TRIDC5AG046620.2  79 KKRYHRHTPQQIQELEAVFKECPHPDEKQRMELSRRLNLESRQVKFWFQNRRTQMK 134
                       688999***********************************************999 PP

2START172.42.9e-542915164205
                       HHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEE CS
             START   4 eeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                       ++a++elvk  ++++p+W  s     e +n de+++ f++  +     + +ea r++g+ + ++++lv++l++   +W+e+++    +a+t+e
  TRIDC5AG046620.2 291 LAAMEELVKVTQVDDPLWQPSLdiglETLNFDEYRRAFARVLGpspagYVSEATREVGIAIINSVDLVNSLMNEV-RWSEMFPcvvaRASTME 382
                       789*******************9***************88666********************************.***************** PP

                       EECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--......-TTSEE-EESSEEEEEEEECTCEEEE CS
             START  84 vissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.....sssvvRaellpSgiliepksnghskv 164
                        issg      g +qlm aelq+lsplvp R+++f+R+++q+ +g wvivdvSvd    p +      ++++ ++llpSg+++e+++ng+ kv
  TRIDC5AG046620.2 383 IISSGmggtrsGSIQLMRAELQVLSPLVPiREVTFLRFCKQHADGLWVIVDVSVDGVLRPDSgtgagPAGYMGCRLLPSGCIVEDMQNGYAKV 475
                       *******************************************************99888877778789************************ PP

                       EEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
             START 165 twvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                       twv h++++++ +h+l+r+l++sg+a ga++w+a lqrqce
  TRIDC5AG046620.2 476 TWVVHAEYDEAAVHELYRPLLRSGQALGARRWLASLQRQCE 516
                       ****************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 787 aa     Download sequence    
CYILYYHPAV HALNTTQTNM EGGGQLGGAF MGSTGSGGDG DSLGRAREDE NDSRSGSDNL  60
DGASADELDP DNSNPRKKKK RYHRHTPQQI QELEAVFKEC PHPDEKQRME LSRRLNLESR  120
QVKFWFQNRR TQMKTQIERH ENALLRQEND KLRTENMTIR EAMRSPTCGN CGGAAVLGEV  180
SLEEQHLRIE NSRLKDELDR VCALAGKFLG RPVSAISSPL SLPSSLCSGL DLAVGSNNGF  240
MGMGMQSIPD LMGGGSAAMR LPAGIMGGGL DDGLGGEGVA IDRGALLELG LAAMEELVKV  300
TQVDDPLWQP SLDIGLETLN FDEYRRAFAR VLGPSPAGYV SEATREVGIA IINSVDLVNS  360
LMNEVRWSEM FPCVVARAST MEIISSGMGG TRSGSIQLMR AELQVLSPLV PIREVTFLRF  420
CKQHADGLWV IVDVSVDGVL RPDSGTGAGP AGYMGCRLLP SGCIVEDMQN GYAKVTWVVH  480
AEYDEAAVHE LYRPLLRSGQ ALGARRWLAS LQRQCEYHAI LCSNPHPNHG DRHEPISPAG  540
RRCMLRLAQR MADNFCAGVC ATAAQKWRRL DEWRVEGAGG RDPAGGEDKV RMMARQSVGA  600
PGEPPGVVLS ATTSVRLPGT PPQRVFDYLR DEQRRGEWDI LANGEAMQEM DHIAKGQHHG  660
NAVSLLRPNA TSGNQNNMLI LQETCTDASG SLVVYAPVDV QSMHVVMGGG DSAYVSLLPS  720
GFAILPDGHT APGSSNNSPG SLVTVAFQIL VNNLPTAKLT VESVDTVSNL LSCTIQKIKS  780
ALQCGDR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17681RKKKKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein