PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC5AG038950.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 270aa    MW: 28832.7 Da    PI: 4.461
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC5AG038950.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.23.3e-1953106356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k++++++eq+++Le+ Fe ++++  e++++LA+ lgL+ rqV vWFqNrRa++k
  TRIDC5AG038950.2  53 KKRRLSAEQVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWK 106
                       45689************************************************9 PP

2HD-ZIP_I/II133.11e-4252144193
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                       ekkrrls+eqv++LE+sFe e+kLeperK++lar+LglqprqvavWFqnrRAR+ktkqlE+dy+aL+++ydal+ ++++L++++e+L +e+++
  TRIDC5AG038950.2  52 EKKRRLSAEQVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKQLERDYNALRHSYDALRVDHDALRRDKEALLAEVRA 144
                       69*************************************************************************************999875 PP

Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    
MKRPGGGNPS SLHQMASPND MDYGVVGMEA DGDAEEEMMA CGGGGGGCGG GEKKRRLSAE  60
QVRALERSFE VENKLEPERK ARLARDLGLQ PRQVAVWFQN RRARWKTKQL ERDYNALRHS  120
YDALRVDHDA LRRDKEALLA EVRAAHGKLG DEEAAASFTS VKEEPAASDG PPPAGMGSSD  180
SDSSGVLNDT DATGATPTEE APAPDMGTLL GGPGAAGAAA AGHGQVFLHG NFLKVEEDET  240
GFLDDEEPCG GFFADEPPLA WWTEPTDPWK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17884ERKARLA
2101109RRARWKTKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.12e-42HD-ZIP family protein