PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC5AG038950.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 206aa    MW: 22010.4 Da    PI: 5.036
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC5AG038950.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.92e-1949102356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k++++++eq+++Le+ Fe ++++  e++++LA+ lgL+ rqV vWFqNrRa++k
  TRIDC5AG038950.1  49 KKRRLSAEQVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWK 102
                       45689************************************************9 PP

2HD-ZIP_I/II133.95.6e-4348140193
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                       ekkrrls+eqv++LE+sFe e+kLeperK++lar+LglqprqvavWFqnrRAR+ktkqlE+dy+aL+++ydal+ ++++L++++e+L +e+++
  TRIDC5AG038950.1  48 EKKRRLSAEQVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKQLERDYNALRHSYDALRVDHDALRRDKEALLAEVRA 140
                       69*************************************************************************************999875 PP

Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    
LAMKRPGGGN PSSLHQMASP NVGMEADGDA EEEMMACGGG GGGCGGGEKK RRLSAEQVRA  60
LERSFEVENK LEPERKARLA RDLGLQPRQV AVWFQNRRAR WKTKQLERDY NALRHSYDAL  120
RVDHDALRRD KEALLAEVRA AHGKLGDEEA AASFTSVKEE PAASDGPPPA GMGSSDSDSS  180
GVLNDTDATG ATPTEEAPAP DMGTLL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17480ERKARLA
297105RRARWKTKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.11e-43HD-ZIP family protein