PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC5AG036880.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 83aa    MW: 9577.24 Da    PI: 12.201
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC5AG036880.5genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.65.1e-19153254
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRak 54
                      rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+
  TRIDC5AG036880.5  1 RKKLRLSKEQAAFLEESFKEHSTLNPRQKVALAKQLNLRPRQVEVWFQNRRAR 53
                      677889**********************************************9 PP

2HD-ZIP_I/II87.51.7e-28154154
       HD-ZIP_I/II  1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARt 54
                      +kk+rlskeq+++LEesF+e+++L+p++Kv+la++L+l+prqv+vWFqnrRAR 
  TRIDC5AG036880.5  1 RKKLRLSKEQAAFLEESFKEHSTLNPRQKVALAKQLNLRPRQVEVWFQNRRARC 54
                      69***************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 83 aa     Download sequence    
RKKLRLSKEQ AAFLEESFKE HSTLNPRQKV ALAKQLNLRP RQVEVWFQNR RARCGAMKSF  60
SFPAPLSLSS RPRILAGQAK TIK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.17e-30HD-ZIP family protein