PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC5AG036880.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 293aa    MW: 31259 Da    PI: 12.0864
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC5AG036880.4genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox38.12.7e-121381672756
                       HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox  27 aeereeLAkklgLterqVkvWFqNrRakek 56 
                       ++++  LAk+l+L  rqV vWFqNrRa+ k
  TRIDC5AG036880.4 138 RKQKVALAKQLNLRPRQVEVWFQNRRARTK 167
                       567889**********************98 PP

2HD-ZIP_I/II93.81.9e-301382032692
       HD-ZIP_I/II  26 perKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                        ++Kv+la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
  TRIDC5AG036880.4 138 RKQKVALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKELAELR-ALK 203
                       489***********************************************************9.555 PP

Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    
CMPCDEIAAG VVVLRRGDPI CSVPFLRAFG GVDAGVRREP GAVVRGLGLG RLRGGGGGAG  60
GHRRGGAGGR VVLAQRQRGL LPDGLLRARR QRRRPGRRRL ARQRRGRRPL GAQEAAPLQG  120
AGRVPGGELQ GAQHPQPRKQ KVALAKQLNL RPRQVEVWFQ NRRARTKLKQ TEVDCEYLKR  180
CCETLTEENR RLQKELAELR ALKTVHPFYM HLPATTLSMC PSCERVASNS APASAAAPSP  240
AAPAPASGAG IASPAAAPEQ HRPSSFAALF SSARSFPLAA PQPQPPLPAP SSS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18994RRQRRR
296103GRRRLARQ
3162170RRARTKLKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.18e-52HD-ZIP family protein