PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC5AG036880.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 277aa    MW: 29778.3 Da    PI: 12.394
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC5AG036880.3genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox38.22.5e-121401692756
                       HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox  27 aeereeLAkklgLterqVkvWFqNrRakek 56 
                       ++++  LAk+l+L  rqV vWFqNrRa+ k
  TRIDC5AG036880.3 140 RKQKVALAKQLNLRPRQVEVWFQNRRARTK 169
                       567889**********************98 PP

2HD-ZIP_I/II93.91.7e-301402052692
       HD-ZIP_I/II  26 perKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                        ++Kv+la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
  TRIDC5AG036880.3 140 RKQKVALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKELAELR-ALK 205
                       489***********************************************************9.555 PP

Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    
VRLVAGAGHA ARAPAHGAQP RLPVAVREQA FGGVDAGVRR EPGAVVRGLG LGRLRGGGGG  60
AGGHRRGGAG GRVVLAQRQR GLLPDGLLRA RRQRRRPGRR RLARQRRGRR PLGAQEAAPL  120
QGAGRVPGGE LQGAQHPQPR KQKVALAKQL NLRPRQVEVW FQNRRARTKL KQTEVDCEYL  180
KRCCETLTEE NRRLQKELAE LRALKTVHPF YMHLPATTLS MCPSCERVAS NSAPASAAAP  240
SPAAPAPASG AGIASPAAAP EQHRPSPSLH CRRRRAR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19196RRQRRR
298105GRRRLARQ
3164172RRARTKLKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.14e-52HD-ZIP family protein