PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC5AG036880.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 355aa    MW: 37298.6 Da    PI: 12.475
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC5AG036880.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox37.73.5e-122002292756
                       HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox  27 aeereeLAkklgLterqVkvWFqNrRakek 56 
                       ++++  LAk+l+L  rqV vWFqNrRa+ k
  TRIDC5AG036880.2 200 RKQKVALAKQLNLRPRQVEVWFQNRRARTK 229
                       567889**********************98 PP

2HD-ZIP_I/II92.25.8e-302012652792
       HD-ZIP_I/II  27 erKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                       ++Kv+la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
  TRIDC5AG036880.2 201 KQKVALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKELAELR-ALK 265
                       89***********************************************************9.555 PP

Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    
GAGAELGGGH GGRRPGAGSG ARGRGRGRPG GGEGGRGEKG SRCRRRRQGW ARVGVRLVAG  60
AGHAARAPAH GAQPRLPVAV REHSVPFLRA FGGVDAGVRR EPGAVVRGLG LGRLRGGGGG  120
AGGHRRGGAG GRVVLAQRQR GLLPDGLLRA RRQRRRPGRR RLARQRRGRR PLGAQEAAPL  180
QGAGRVPGGE LQGAQHPQPR KQKVALAKQL NLRPRQVEVW FQNRRARTKL KQTEVDCEYL  240
KRCCETLTEE NRRLQKELAE LRALKTVHPF YMHLPATTLS MCPSCERVAS NSAPASAAAP  300
SPAAPAPASG AGIASPAAAP EQHRPSSFAA LFSSARSFPL AAPQPQPPLP APSSS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1151156RRQRRR
2158165GRRRLARQ
3224232RRARTKLKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.13e-51HD-ZIP family protein