PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC5AG036880.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 360aa    MW: 37766.3 Da    PI: 11.8768
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC5AG036880.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox37.73.6e-122052342756
                       HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox  27 aeereeLAkklgLterqVkvWFqNrRakek 56 
                       ++++  LAk+l+L  rqV vWFqNrRa+ k
  TRIDC5AG036880.1 205 RKQKVALAKQLNLRPRQVEVWFQNRRARTK 234
                       567889**********************98 PP

2HD-ZIP_I/II92.25.9e-302062702792
       HD-ZIP_I/II  27 erKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                       ++Kv+la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
  TRIDC5AG036880.1 206 KQKVALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKELAELR-ALK 270
                       89***********************************************************9.555 PP

Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    
MELGLSLGEA MADAGRELVL GLGVGVGVGP GAAREGEGRR DHDVGAAARG GLALGCGSSP  60
EPAMRLALLP MVPSLGFPWP SESSDPICSV PFLRAFGGVD AGVRREPGAV VRGLGLGRLR  120
GGGGGAGGHR RGGAGGRVVL AQRQRGLLPD GLLRARRQRR RPGRRRLARQ RRGRRPLGAQ  180
EAAPLQGAGR VPGGELQGAQ HPQPRKQKVA LAKQLNLRPR QVEVWFQNRR ARTKLKQTEV  240
DCEYLKRCCE TLTEENRRLQ KELAELRALK TVHPFYMHLP ATTLSMCPSC ERVASNSAPA  300
SAAAPSPAAP APASGAGIAS PAAAPEQHRP SSFAALFSSA RSFPLAAPQP QPPLPAPSSS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1156161RRQRRR
2163170GRRRLARQ
3229237RRARTKLKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-51HD-ZIP family protein