PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC5AG036270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family ZF-HD
Protein Properties Length: 67aa    MW: 7175.69 Da    PI: 6.0612
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC5AG036270.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer82.26e-261501060
       ZF-HD_dimer 10 lkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                      ++NhAas+Gg+avDGC+Ef+++ geegt  alkC+ACgCHR+FH r +++e
  TRIDC5AG036270.1  1 RRNHAASTGGYAVDGCREFIAE-GEEGTFGALKCSACGCHRSFHHRVQVYE 50
                      69*******************8.999********************99876 PP

Sequence ? help Back to Top
Protein Sequence    Length: 67 aa     Download sequence    
RRNHAASTGG YAVDGCREFI AEGEEGTFGA LKCSACGCHR SFHHRVQVYE VAWDCESDTS  60
SSSSSSS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.13e-22ZF-HD family protein