PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC5AG024000.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family ZF-HD
Protein Properties Length: 94aa    MW: 9856 Da    PI: 7.3404
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC5AG024000.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer93.91.4e-292881358
       ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                       v+YkeC++NhAa +Gg+avDGC+Efm+s    + a+al CaACgCHR+FH+reve
  TRIDC5AG024000.1 28 VVHYKECQRNHAAGIGGYAVDGCREFMASAP--AGAEALLCAACGCHRSFHKREVE 81
                      689*************************944..459*****************987 PP

Sequence ? help Back to Top
Protein Sequence    Length: 94 aa     Download sequence    
MGPQQDRSAS KALANGTAVA PERKDGKVVH YKECQRNHAA GIGGYAVDGC REFMASAPAG  60
AEALLCAACG CHRSFHKREV EAVECDCSSD TSGR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.12e-17ZF-HD family protein