PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | TRIDC4BG052950.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 57aa MW: 6184.03 Da PI: 11.5635 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 37 | 7.7e-12 | 14 | 45 | 1 | 32 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 rg+W+teEd +l + v+++G g+W+ I+r g TRIDC4BG052950.1 14 RGPWSTEEDAKLMNHVAKHGLGRWSDIPRLAG 45 89***************************999 PP |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 57 aa Download sequence |
MSKAPRGPRK AVRRGPWSTE EDAKLMNHVA KHGLGRWSDI PRLAGTYGTN SPSGPTV |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G21440.1 | 1e-11 | MYB family protein |
Link Out ? help Back to Top | |
---|---|
Ensembl | TRIDC4BG052950.1 |