PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC4BG052050.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 316aa    MW: 35085.8 Da    PI: 4.7143
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC4BG052050.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.21.6e-1964115556
                       SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++  eq+++Le+ Fe +++++ e+++++A+ lgL  rqV vWFqNrRa++k
  TRIDC4BG052050.2  64 RRLALEQVRALERSFETDNKLDPERKARIARDLGLHPRQVAVWFQNRRARWK 115
                       467789*********************************************9 PP

2HD-ZIP_I/II128.52.7e-4162153293
       HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                       kkrrl+ eqv++LE+sFe+++kL+perK+++ar+Lgl+prqvavWFqnrRAR+ktkqlE+d++aL++++dal+++ ++L++++++L++e++e
  TRIDC4BG052050.2  62 KKRRLALEQVRALERSFETDNKLDPERKARIARDLGLHPRQVAVWFQNRRARWKTKQLERDFNALRARHDALRADCDALRRDKDALAAEVHE 153
                       9**************************************************************************************99986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    
MKRQIKRPTR SQESPEPGEK LAFAEKEHLL AAYMEHDEPE LEEADEEEEE EERAMSCGLG  60
GKKRRLALEQ VRALERSFET DNKLDPERKA RIARDLGLHP RQVAVWFQNR RARWKTKQLE  120
RDFNALRARH DALRADCDAL RRDKDALAAE VHELREKLSI KPETAVKAEA TGNVDAAEER  180
LQQATMVGAT VCKDGSSDSD SSAVFNDEAS PYSSAVFEQQ GFMGFGASFL DSASAAAATT  240
GCSSLPMLEP KWPGAYPYDA NRSGGYGFTE EWLAGSDAIV NDGSSAFFSE EHVSNLNFGW  300
CSSGAEGFDL QSYCKK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1110118RRARWKTKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.12e-31HD-ZIP family protein