PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC4BG049410.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 334aa    MW: 36848.1 Da    PI: 6.8257
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC4BG049410.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.64.2e-18121174356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rqV +WFqNrRa++k
  TRIDC4BG049410.2 121 KKRRLNVEQVRTLEKNFEVANKLEPERKMQLARALGLQPRQVAIWFQNRRARWK 174
                       4568999**********************************************9 PP

2HD-ZIP_I/II130.66.3e-42120210191
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                       ekkrrl+ eqv++LE++Fe  +kLeperK++lar+Lglqprqva+WFqnrRAR+ktkqlEkdy++Lkr++da+k+en++L +++++L++e+
  TRIDC4BG049410.2 120 EKKRRLNVEQVRTLEKNFEVANKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDVLKRQFDAVKAENDALLSHNKKLQSEI 210
                       69**************************************************************************************987 PP

Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    
KKPMASNGMA SSPSAFFPPN FLLHMQQAPP QHDPQEHHQQ HHHHHHEHHL PPPHPQHNPF  60
LPSPQCPSLQ DFRGGLSPML GKRPAMYGGG GDGGCGGDEV TGGGANEEET SDDGSQLGGE  120
KKRRLNVEQV RTLEKNFEVA NKLEPERKMQ LARALGLQPR QVAIWFQNRR ARWKTKQLEK  180
DYDVLKRQFD AVKAENDALL SHNKKLQSEI LGLKGCREAA SELINLNKET EASCSNRSEN  240
SSEINLDISR TPPSDGPMDA PPSHQQGGGG GGMIPFYPSV ARPAGVDIDH LLHASVPKME  300
HHHGGPDTPS FGNLLCGVDE PPPFWPWADH QQFN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1169177RRARWKTKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.11e-80HD-ZIP family protein