PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC4BG045310.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 190aa    MW: 20758 Da    PI: 6.9534
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC4BG045310.3genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.92.1e-1962115356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k++++++eq + Le  F+k+r++ + ++ +LA++lgL+++qV vWFqNrRa++k
  TRIDC4BG045310.3  62 KKRRLSDEQAQFLEMSFRKERKLETPRKVQLAAELGLDTKQVAVWFQNRRARYK 115
                       45689************************************************9 PP

2HD-ZIP_I/II110.11.5e-3562145285
       HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeve 85 
                       kkrrls+eq+++LE+sF++e+kLe+ rKv+la eLgl+++qvavWFqnrRAR+k+k +E+++++L++a+da++ +n++Le+ev+
  TRIDC4BG045310.3  62 KKRRLSDEQAQFLEMSFRKERKLETPRKVQLAAELGLDTKQVAVWFQNRRARYKSKLIEEEFSKLRAAHDAVVVHNCHLEAEVQ 145
                       9********************************************************************************987 PP

Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    
MSPEEGERLL FPSFVFPDGF PADDATPAVS GGEQKKAGRQ RRRRRARQAA AGEGAGGDDA  60
AKKRRLSDEQ AQFLEMSFRK ERKLETPRKV QLAAELGLDT KQVAVWFQNR RARYKSKLIE  120
EEFSKLRAAH DAVVVHNCHL EAEVQCNTAE AQGEVGGDGG GEEQGHGGGG GGDNGRRGWQ  180
QPELFVVLDG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14165RRRRRARQAAAGEGAGGDDAAKKRR
24266RRRRRARQAAAGEGAGGDDAAKKRR
34367RRRRRARQAAAGEGAGGDDAAKKRR
46283KKRRLSDEQAQFLEMSFRKERK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.18e-31HD-ZIP family protein