PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC4BG045310.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 233aa    MW: 25576.6 Da    PI: 6.3107
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC4BG045310.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.33e-1962115356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k++++++eq + Le  F+k+r++ + ++ +LA++lgL+++qV vWFqNrRa++k
  TRIDC4BG045310.1  62 KKRRLSDEQAQFLEMSFRKERKLETPRKVQLAAELGLDTKQVAVWFQNRRARYK 115
                       45689************************************************9 PP

2HD-ZIP_I/II112.33.1e-3662153293
       HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                       kkrrls+eq+++LE+sF++e+kLe+ rKv+la eLgl+++qvavWFqnrRAR+k+k +E+++++L++a+da++ +n++Le+e  +L+e+l+e
  TRIDC4BG045310.1  62 KKRRLSDEQAQFLEMSFRKERKLETPRKVQLAAELGLDTKQVAVWFQNRRARYKSKLIEEEFSKLRAAHDAVVVHNCHLEAELLRLKERLAE 153
                       9**************************************************************************************99975 PP

Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    
MSPEEGERLL FPSFVFPDGF PADDATPAVS GGEQKKAGRQ RRRRRARQAA AGEGAGGDDA  60
AKKRRLSDEQ AQFLEMSFRK ERKLETPRKV QLAAELGLDT KQVAVWFQNR RARYKSKLIE  120
EEFSKLRAAH DAVVVHNCHL EAELLRLKER LAETEEEKNK AMAAAAAATT GGGGGSSPSS  180
SSFSTVTAMV GGQQFGMEEV ETDLTYMSEY AYTNYMMDLA AGGYLGGVYD QFS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14165RRRRRARQAAAGEGAGGDDAAKKRR
24266RRRRRARQAAAGEGAGGDDAAKKRR
34367RRRRRARQAAAGEGAGGDDAAKKRR
46283KKRRLSDEQAQFLEMSFRKERK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.15e-28HD-ZIP family protein